Active Recombinant Full Length Human G0S2 Protein, C-Flag-tagged
Cat.No. : | G0S2-438HFL |
Product Overview : | Recombinant Full Length Human G0S2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity regulator |
Molecular Mass : | 11.1 kDa |
AA Sequence : | METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAAL ERQALQKQALQEKGKQQDTVLGGRALSNRQHASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | G0S2 G0/G1 switch 2 [ Homo sapiens (human) ] |
Official Symbol | G0S2 |
Synonyms | RP1-28O10.2 |
Gene ID | 50486 |
mRNA Refseq | NM_015714.4 |
Protein Refseq | NP_056529.1 |
MIM | 614447 |
UniProt ID | P27469 |
◆ Recombinant Proteins | ||
G0S2-2089R | Recombinant Rat G0S2 Protein, His (Fc)-Avi-tagged | +Inquiry |
G0s2-3121M | Recombinant Mouse G0s2 Protein, Myc/DDK-tagged | +Inquiry |
G0S2-2433R | Recombinant Rat G0S2 Protein | +Inquiry |
G0S2-1600R | Recombinant Rhesus Macaque G0S2 Protein, His (Fc)-Avi-tagged | +Inquiry |
G0S2-1779R | Recombinant Rhesus monkey G0S2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
G0S2-6086HCL | Recombinant Human G0S2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All G0S2 Products
Required fields are marked with *
My Review for All G0S2 Products
Required fields are marked with *