Active Recombinant Full Length Human G0S2 Protein, C-Flag-tagged

Cat.No. : G0S2-438HFL
Product Overview : Recombinant Full Length Human G0S2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : Enzyme activity regulator
Molecular Mass : 11.1 kDa
AA Sequence : METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAAL
ERQALQKQALQEKGKQQDTVLGGRALSNRQHASTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Transmembrane
Full Length : Full L.
Gene Name G0S2 G0/G1 switch 2 [ Homo sapiens (human) ]
Official Symbol G0S2
Synonyms RP1-28O10.2
Gene ID 50486
mRNA Refseq NM_015714.4
Protein Refseq NP_056529.1
MIM 614447
UniProt ID P27469

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All G0S2 Products

Required fields are marked with *

My Review for All G0S2 Products

Required fields are marked with *

0
cart-icon
0
compare icon