Active Recombinant Full Length Human HNRNPK Protein, C-Flag-tagged
Cat.No. : | HNRNPK-34HFL |
Product Overview : | Recombinant Full Length Human HNRNPK Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene is located in the nucleoplasm and has three repeats of KH domains that binds to RNAs. It is distinct among other hnRNP proteins in its binding preference; it binds tenaciously to poly(C). This protein is also thought to have a role during cell cycle progession. Several alternatively spliced transcript variants have been described for this gene, however, not all of them are fully characterized. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | HNRNPK Activity verified in a DNA-binding assay. |
Molecular Mass : | 50.8 kDa |
AA Sequence : | METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRT DYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKG SDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIIL DLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDY DDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAID TWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Spliceosome |
Full Length : | Full L. |
Gene Name | HNRNPK heterogeneous nuclear ribonucleoprotein K [ Homo sapiens (human) ] |
Official Symbol | HNRNPK |
Synonyms | AUKS; CSBP; TUNP; HNRPK |
Gene ID | 3190 |
mRNA Refseq | NM_002140.5 |
Protein Refseq | NP_002131.2 |
MIM | 600712 |
UniProt ID | P61978 |
◆ Recombinant Proteins | ||
Hnrnpk-5684M | Recombinant Mouse Hnrnpk Protein (Met1-Phe463), N-His tagged | +Inquiry |
HNRNPK-2801H | Recombinant Human HNRNPK protein(11-100 aa), C-His-tagged | +Inquiry |
HNRNPK-4263M | Recombinant Mouse HNRNPK Protein, His (Fc)-Avi-tagged | +Inquiry |
HNRNPK-12238Z | Recombinant Zebrafish HNRNPK | +Inquiry |
HNRNPK-1089H | Recombinant Human HNRNPK Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPK-5442HCL | Recombinant Human HNRNPK 293 Cell Lysate | +Inquiry |
HNRNPK-5443HCL | Recombinant Human HNRNPK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HNRNPK Products
Required fields are marked with *
My Review for All HNRNPK Products
Required fields are marked with *
0
Inquiry Basket