Active Recombinant Full Length Human HSPA5 Protein, C-Flag-tagged
| Cat.No. : | HSPA5-52HFL |
| Product Overview : | Recombinant Full Length Human HSPA5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is a member of the heat shock protein 70 (HSP70) family. This protein localizes to the lumen of the endoplasmic reticulum (ER) where it operates as a typical HSP70 chaperone involved in the folding and assembly of proteins in the ER and is a master regulator of ER homeostasis. During cellular stress, as during viral infection or tumorogenesis, this protein interacts with the transmembrane stress sensor proteins PERK (protein kinase R-like endoplasmic reticulum kinase), IRE1 (inositol-requiring kinase 1), and ATF6 (activating transcription factor 6) where it acts as a repressor of the unfolded protein response (UPR) and also plays a role in cellular apoptosis and senescence. Elevated expression and atypical translocation of this protein to the cell surface has been reported in viral infections and some types of cancer cells. At the cell surface this protein may facilitate viral attachment and entry to host cells. This gene is a therapeutic target for the treatment of coronavirus diseases and chemoresistant cancers. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | Protein refolding WB positive control Ubiquitination substrate |
| Molecular Mass : | 72.2 kDa |
| AA Sequence : | MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTP EGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTF APEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYG LDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRK DNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSD LKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPA PRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERID TRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPI ISKLYGSAGPPPTGEEDTAEKDELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Protein Pathways : | Antigen processing and presentation, Prion diseases |
| Full Length : | Full L. |
| Gene Name | HSPA5 heat shock protein family A (Hsp70) member 5 [ Homo sapiens (human) ] |
| Official Symbol | HSPA5 |
| Synonyms | BIP; GRP78; HEL-S-89n; MIF2 |
| Gene ID | 3309 |
| mRNA Refseq | NM_005347.5 |
| Protein Refseq | NP_005338.1 |
| MIM | 138120 |
| UniProt ID | P11021 |
| ◆ Recombinant Proteins | ||
| Hspa5-571M | Recombinant Mouse Hspa5 Protein, His-tagged | +Inquiry |
| HSPA5-2948R | Recombinant Rat HSPA5 Protein | +Inquiry |
| HSPA5-1986R | Recombinant Rhesus Macaque HSPA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HSPA5-332H | Recombinant Human Heat Shock 70kDa Protein 5 (Glucose-regulated Protein, 78kDa), His-tagged | +Inquiry |
| HSPA5-5108H | Recombinant Human HSPA5 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPA5-010HKCL | Human HSPA5 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPA5 Products
Required fields are marked with *
My Review for All HSPA5 Products
Required fields are marked with *
