Active Recombinant Full Length Human HTRA1 Protein, C-Flag-tagged
Cat.No. : | HTRA1-19HFL |
Product Overview : | Recombinant Full Length Human HTRA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Protein degradation enzyme Enzyme activity |
Molecular Mass : | 49 kDa |
AA Sequence : | MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCG APEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRR SERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGF IVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPG EFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTL KVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYI IEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease, Secreted Protein |
Full Length : | Full L. |
Gene Name | HTRA1 HtrA serine peptidase 1 [ Homo sapiens (human) ] |
Official Symbol | HTRA1 |
Synonyms | L56; HtrA; ARMD7; ORF480; PRSS11; CARASIL; CADASIL2 |
Gene ID | 5654 |
mRNA Refseq | NM_002775.5 |
Protein Refseq | NP_002766.1 |
MIM | 602194 |
UniProt ID | Q92743 |
◆ Recombinant Proteins | ||
HTRA1-2177R | Recombinant Rhesus monkey HTRA1 Protein, His-tagged | +Inquiry |
HtrA1-2889H | Recombinant Human HtrA1, Truncated, His-tagged | +Inquiry |
HTRA1-5712HF | Recombinant Full Length Human HTRA1 Protein, GST-tagged | +Inquiry |
HTRA1-2627R | Recombinant Rat HTRA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HTRA1-1998R | Recombinant Rhesus Macaque HTRA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTRA1-5329HCL | Recombinant Human HTRA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTRA1 Products
Required fields are marked with *
My Review for All HTRA1 Products
Required fields are marked with *
0
Inquiry Basket