Active Recombinant Full Length Human HYAL1 Protein

• Cat.No.: HYAL1-247HF
• Product Overview: Recombinant full length Human HYAL1 with proprietary tag; Predicted MWt 53.9 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 253 amino acids
• Description: This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene.
• Bio-activity: Useful for Antibody Production and Protein Array
• Molecular Mass: 53.900kDa inclusive of tags
• AA Sequence: MAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: HYAL1 hyaluronoglucosaminidase 1 [ Homo sapiens ]
• Official Symbol: HYAL1
• Synonyms: HYAL1; hyaluronoglucosaminidase 1; hyaluronidase-1; FUS2; HYAL 1; LUCA1; NAT6
• Gene ID: 3373
• mRNA Refseq: NM_007312
• Protein Refseq: NP_009296
• MIM: 607071
• UniProt ID: Q12794