Active Recombinant Full Length Human JUP Protein, C-Flag-tagged
Cat.No. : | JUP-295HFL |
Product Overview : | Recombinant Full Length Human JUP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a major cytoplasmic protein which is the only known constituent common to submembranous plaques of both desmosomes and intermediate junctions. This protein forms distinct complexes with cadherins and desmosomal cadherins and is a member of the catenin family since it contains a distinct repeating amino acid motif called the armadillo repeat. Mutation in this gene has been associated with Naxos disease. Alternative splicing occurs in this gene; however, not all transcripts have been fully described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Surface Plasmon Ressonance (SPR) |
Molecular Mass : | 81.6 kDa |
AA Sequence : | MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQG DLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELA TRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILH NLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKN NPKFLAITTDCLQLLAYGNQESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVE AGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLN QPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIV EGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPL MELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDLDAT YRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Acute myeloid leukemia, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Pathways in cancer |
Full Length : | Full L. |
Gene Name | JUP junction plakoglobin [ Homo sapiens (human) ] |
Official Symbol | JUP |
Synonyms | PG; DP3; PDGB; PKGB; CTNNG; DPIII |
Gene ID | 3728 |
mRNA Refseq | NM_002230.4 |
Protein Refseq | NP_002221.1 |
MIM | 173325 |
UniProt ID | P14923 |
◆ Recombinant Proteins | ||
JUP-3149R | Recombinant Rat JUP Protein | +Inquiry |
JUP-2158R | Recombinant Rhesus Macaque JUP Protein, His (Fc)-Avi-tagged | +Inquiry |
JUP-2337R | Recombinant Rhesus monkey JUP Protein, His-tagged | +Inquiry |
JUP-1438H | Recombinant Human JUP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
JUP-295HFL | Active Recombinant Full Length Human JUP Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JUP-5094HCL | Recombinant Human JUP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All JUP Products
Required fields are marked with *
My Review for All JUP Products
Required fields are marked with *
0
Inquiry Basket