Active Recombinant Full Length Human LMOD1 Protein, C-Flag-tagged
Cat.No. : | LMOD1-496HFL |
Product Overview : | Recombinant Full Length Human LMOD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The leiomodin 1 protein has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | ELISA capture for autoantibodies |
Molecular Mass : | 66.8 kDa |
AA Sequence : | MSRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLN FCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDE AGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREE MKEVAKKEDDEKVKGERRNTDTRKEGEKMKRAGGNTDMKKEDEKVKRGTGNTDTKKDDEKVKKNEPLHEK EAKDDSKTKTPEKQTPSGPTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVR FTEALEFNTVVKLFALANTRADDHVAFAIAIMLKANKTITSLNLDSNHITGKGILAIFRALLQNNTLTEL RFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKRLQEQRQAQEAKG EKKDLLEVPKAGAVAKGSPKPSPQPSPKPSPKNSPKKGGAPAAPPPPPPPLAPPLIMENLKNSLSPATQR KMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | LMOD1 leiomodin 1 [ Homo sapiens (human) ] |
Official Symbol | LMOD1 |
Synonyms | 1D; D1; 64kD; MMIHS3; SMLMOD; SM-LMOD |
Gene ID | 25802 |
mRNA Refseq | NM_012134.3 |
Protein Refseq | NP_036266.2 |
MIM | 602715 |
UniProt ID | P29536 |
◆ Recombinant Proteins | ||
LMOD1-1308H | Recombinant Human LMOD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lmod1-3802M | Recombinant Mouse Lmod1 Protein, Myc/DDK-tagged | +Inquiry |
LMOD1-2841H | Recombinant Human LMOD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LMOD1-496HFL | Active Recombinant Full Length Human LMOD1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMOD1-4706HCL | Recombinant Human LMOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LMOD1 Products
Required fields are marked with *
My Review for All LMOD1 Products
Required fields are marked with *
0
Inquiry Basket