Active Recombinant Full Length Human LRATD1 Protein, C-Flag-tagged

Cat.No. : LRATD1-491HFL
Product Overview : Recombinant Full Length Human LRATD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Involved in cell morphogenesis and cell motility. Predicted to be located in cytoplasm.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : Immunoprecipitation
Molecular Mass : 32.3 kDa
AA Sequence : MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSR HHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAP APHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWT NSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRV
LQELADLVDDKETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name LRATD1 LRAT domain containing 1 [ Homo sapiens (human) ]
Official Symbol LRATD1
Synonyms NSE1; FAM84A; PP11517
Gene ID 151354
mRNA Refseq NM_145175.4
Protein Refseq NP_660158.2
MIM 611234
UniProt ID Q96KN4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRATD1 Products

Required fields are marked with *

My Review for All LRATD1 Products

Required fields are marked with *

0
cart-icon