Active Recombinant Full Length Human NEU3 Protein, C-Flag-tagged
| Cat.No. : | NEU3-35HFL |
| Product Overview : | Recombinant Full Length Human NEU3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene product belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. It is localized in the plasma membrane, and its activity is specific for gangliosides. It may play a role in modulating the ganglioside content of the lipid bilayer. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | Cell treatment |
| Molecular Mass : | 51.5 kDa |
| AA Sequence : | MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHT FLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICV RGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIP AYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTP NRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRL EEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFE CGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Pathways : | Other glycan degradation, Sphingolipid metabolism |
| Full Length : | Full L. |
| Gene Name | NEU3 neuraminidase 3 [ Homo sapiens (human) ] |
| Official Symbol | NEU3 |
| Synonyms | SIAL3 |
| Gene ID | 10825 |
| mRNA Refseq | NM_006656.6 |
| Protein Refseq | NP_006647.3 |
| MIM | 604617 |
| UniProt ID | Q9UQ49 |
| ◆ Recombinant Proteins | ||
| NEU3-301462H | Recombinant Human NEU3 protein, GST-tagged | +Inquiry |
| NEU3-1503H | Recombinant Human NEU3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NEU3-3961R | Recombinant Rat NEU3 Protein | +Inquiry |
| Neu3-4838M | Recombinant Mouse Neu3 protein, His-tagged | +Inquiry |
| NEU3-752H | Recombinant Human NEU3 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEU3 Products
Required fields are marked with *
My Review for All NEU3 Products
Required fields are marked with *
