Active Recombinant Full Length Human NEU3 Protein, C-Flag-tagged
Cat.No. : | NEU3-35HFL |
Product Overview : | Recombinant Full Length Human NEU3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene product belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. It is localized in the plasma membrane, and its activity is specific for gangliosides. It may play a role in modulating the ganglioside content of the lipid bilayer. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 51.5 kDa |
AA Sequence : | MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHT FLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICV RGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIP AYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTP NRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRL EEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFE CGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Other glycan degradation, Sphingolipid metabolism |
Full Length : | Full L. |
Gene Name | NEU3 neuraminidase 3 [ Homo sapiens (human) ] |
Official Symbol | NEU3 |
Synonyms | SIAL3 |
Gene ID | 10825 |
mRNA Refseq | NM_006656.6 |
Protein Refseq | NP_006647.3 |
MIM | 604617 |
UniProt ID | Q9UQ49 |
◆ Recombinant Proteins | ||
NEU3-4603H | Recombinant Human NEU3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NEU3-708H | Recombinant Human NEU3 | +Inquiry |
Neu3-4380M | Recombinant Mouse Neu3 Protein, Myc/DDK-tagged | +Inquiry |
NEU3-35HFL | Active Recombinant Full Length Human NEU3 Protein, C-Flag-tagged | +Inquiry |
NEU3-3933H | Recombinant Human NEU3 Protein (Met1-Asn428), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEU3 Products
Required fields are marked with *
My Review for All NEU3 Products
Required fields are marked with *