Active Recombinant Full Length Human NR1H2 Protein, C-Flag-tagged
Cat.No. : | NR1H2-226HFL |
Product Overview : | Recombinant Full Length Human NR1H2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The liver X receptors, LXRA and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducible LXRA is highly expressed in liver, adrenal gland, intestine, adipose tissue, macrophages, lung, and kidney, whereas LXRB is ubiquitously expressed. Ligand-activated LXRs form obligate heterodimers with retinoid X receptors and regulate expression of target genes containing LXR response elements. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Surface Plasmon Ressonance (SPR) |
Molecular Mass : | 50.9 kDa |
AA Sequence : | MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPE RKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRK CQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQ GSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQ EIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFI NPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPR MLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Full Length : | Full L. |
Gene Name | NR1H2 nuclear receptor subfamily 1 group H member 2 [ Homo sapiens (human) ] |
Official Symbol | NR1H2 |
Synonyms | NER; UNR; LXRB; LXR-b; NER-I; RIP15 |
Gene ID | 7376 |
mRNA Refseq | NM_007121.7 |
Protein Refseq | NP_009052.4 |
MIM | 600380 |
UniProt ID | P55055 |
◆ Recombinant Proteins | ||
NR1H2-6180M | Recombinant Mouse NR1H2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nr1h2-7889M | Recombinant Mouse Nr1h2 protein, His & T7-tagged | +Inquiry |
NR1H2-1061H | Active Recombinant Human NR1H2, 211-461aa | +Inquiry |
NR1H2-2279H | Recombinant Human NR1H2 protein | +Inquiry |
NR1H2-27981TH | Recombinant Human NR1H2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR1H2-440HCL | Recombinant Human NR1H2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR1H2 Products
Required fields are marked with *
My Review for All NR1H2 Products
Required fields are marked with *
0
Inquiry Basket