Active Recombinant Full Length Human NR1H3 Protein, C-Flag-tagged
Cat.No. : | NR1H3-464HFL |
Product Overview : | Recombinant Full Length Human NR1H3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the NR1 subfamily of the nuclear receptor superfamily. The NR1 family members are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. This protein is highly expressed in visceral organs, including liver, kidney and intestine. It forms a heterodimer with retinoid X receptor (RXR), and regulates expression of target genes containing retinoid response elements. Studies in mice lacking this gene suggest that it may play an important role in the regulation of cholesterol homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Binding assay (Blue Native PAGE) |
Molecular Mass : | 50.2 kDa |
AA Sequence : | MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRA EPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHC PMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHATSLPPRASSPPQILPQLSPEQ LGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQ LSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQ LNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV HSEQVFALRLQDKKLPPLLSEIWDVHETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways : | PPAR signaling pathway |
Full Length : | Full L. |
Gene Name | NR1H3 nuclear receptor subfamily 1 group H member 3 [ Homo sapiens (human) ] |
Official Symbol | NR1H3 |
Synonyms | LXRA; LXR-a; RLD-1 |
Gene ID | 10062 |
mRNA Refseq | NM_005693.4 |
Protein Refseq | NP_005684.2 |
MIM | 602423 |
UniProt ID | Q13133 |
◆ Recombinant Proteins | ||
NR1H3-6111C | Recombinant Chicken NR1H3 | +Inquiry |
NR1H3-1056H | Active Recombinant Human NR1H3, LB Domain | +Inquiry |
NR1H3-6699HF | Recombinant Full Length Human NR1H3 Protein, GST-tagged | +Inquiry |
NR1H3-1058H | Active Recombinant Human NR1H3, 1-182aa, GST-tagged | +Inquiry |
NR1H3-3862H | Recombinant Human NR1H3 Protein (Asn95-Lys434), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR1H3-3720HCL | Recombinant Human NR1H3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR1H3 Products
Required fields are marked with *
My Review for All NR1H3 Products
Required fields are marked with *
0
Inquiry Basket