Active Recombinant Full Length Human PFKP Protein, C-Flag-tagged
Cat.No. : | PFKP-284HFL |
Product Overview : | Recombinant Full Length Human PFKP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the phosphofructokinase A protein family. The encoded enzyme is the platelet-specific isoform of phosphofructokinase and plays a key role in glycolysis regulation. This gene may play a role in metabolic reprogramming in some cancers, including clear cell renal cell carcinomas, and cancer of the bladder, breast, and lung. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 85.4 kDa |
AA Sequence : | MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDG GSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKE WSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQR TFVLEVMGRHCGYLALVSALACGADWVFLPESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQN KPITSEKIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGN HAVRLPLMECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKRVLPGKYLEE IATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTIT DTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEEPFDIRDLQSNVEHLTEKMKTTI QRGLVLRNESCSENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAK LKEARGRGKKFTTDDSICVLGISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDV SDSGQLEHVQPWSVSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Fructose and mannose metabolism, Galactose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway |
Full Length : | Full L. |
Gene Name | PFKP phosphofructokinase, platelet [ Homo sapiens (human) ] |
Official Symbol | PFKP |
Synonyms | PFKF; PFK-C; PFK-P; ATP-PFK |
Gene ID | 5214 |
mRNA Refseq | NM_002627.5 |
Protein Refseq | NP_002618.1 |
MIM | 171840 |
UniProt ID | Q01813 |
◆ Recombinant Proteins | ||
Pfkp-4811M | Recombinant Mouse Pfkp Protein, Myc/DDK-tagged | +Inquiry |
PFKP-1654H | Recombinant Human PFKP Protein, His (Fc)-Avi-tagged | +Inquiry |
PFKP-12666M | Recombinant Mouse Pfkp Protein, MYC/DDK-tagged | +Inquiry |
PFKP-30890TH | Recombinant Human PFKP, His-tagged | +Inquiry |
PFKP-4872H | Recombinant Human PFKP Protein (Asp553-Lys753), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFKP-3270HCL | Recombinant Human PFKP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFKP Products
Required fields are marked with *
My Review for All PFKP Products
Required fields are marked with *
0
Inquiry Basket