Active Recombinant Full Length Human PSG1 Protein, C-Flag-tagged
Cat.No. : | PSG1-696HFL |
Product Overview : | Recombinant Full Length Human PSG1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The human placenta is a multihormonal endocrine organ that produces hormones, enzymes, and other molecules that support fetal survival and development. Pregnancy-specific beta-1-glycoprotein (PSBG, PSG) is a major product of the syncytiotrophoblast, reaching concentrations of 100 to 290 mg/l at term in the serum of pregnant women (Horne et al., 1976 [PubMed 971765]). PSG is a member of the immunoglobulin (Ig) superfamily (Watanabe and Chou, 1988 [PubMed 3257488]; Streydio et al., 1988 [PubMed 3260773]). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Sulfhydration substrate |
Molecular Mass : | 47.7 kDa |
AA Sequence : | MGTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAQVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKG QMRDLYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTF TLHLETPKPSISSSNLNPRETMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLKLSETNRTLFLLGVTKY TAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSL PVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVL YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSATGKESSKSMTVEVSGKWIPA SLAIGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | PSG1 pregnancy specific beta-1-glycoprotein 1 [ Homo sapiens (human) ] |
Official Symbol | PSG1 |
Synonyms | SP1; B1G1; PBG1; CD66f; PSBG1; PSG95; PSGGA; DHFRP2; PSBG-1; PSGIIA; FL-NCA-1/2; PS-beta-C/D; PS-beta-G-1 |
Gene ID | 5669 |
mRNA Refseq | NM_006905.3 |
Protein Refseq | NP_008836.2 |
MIM | 176390 |
UniProt ID | P11464 |
◆ Recombinant Proteins | ||
PSG1-696HFL | Active Recombinant Full Length Human PSG1 Protein, C-Flag-tagged | +Inquiry |
PSG1-1376H | Recombinant Human PSG1 Protein (Leu202-Thr401), N-His tagged | +Inquiry |
PSG1-6025H | Recombinant Human PSG1 Protein (Gln35-Pro419), C-His tagged | +Inquiry |
PSG1-671H | Recombinant Human PSG1 Protein, His-tagged | +Inquiry |
PSG1-189H | Recombinant Human PSG1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSG1-2788HCL | Recombinant Human PSG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSG1 Products
Required fields are marked with *
My Review for All PSG1 Products
Required fields are marked with *
0
Inquiry Basket