Active Recombinant Full Length Human PUF60 Protein, C-Flag-tagged
Cat.No. : | PUF60-97HFL |
Product Overview : | Recombinant Full Length Human PUF60 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a nucleic acid-binding protein that plays a role in a variety of nuclear processes, including pre-mRNA splicing and transcriptional regulation. The encoded protein forms a complex with the far upstream DNA element (FUSE) and FUSE-binding protein at the myelocytomatosis oncogene (MYC) promoter. This complex represses MYC transcription through the core-TFIIH basal transcription factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | WB positive control ELISA capture for autoantibodies |
Molecular Mass : | 59.7 kDa |
AA Sequence : | MATATIALVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLTPEQQEALQKA KKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQRQRALAIMCRVYVGSIYYE LGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNI GQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKA QSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLG TLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEP KKEKEEEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVT EECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFD NSDLSATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Spliceosome |
Full Length : | Full L. |
Gene Name | PUF60 poly(U) binding splicing factor 60 [ Homo sapiens (human) ] |
Official Symbol | PUF60 |
Synonyms | FIR; VRJS; RoBPI; SIAHBP1 |
Gene ID | 22827 |
mRNA Refseq | NM_078480.3 |
Protein Refseq | NP_510965.1 |
MIM | 604819 |
UniProt ID | Q9UHX1 |
◆ Recombinant Proteins | ||
PUF60-13719M | Recombinant Mouse PUF60 Protein | +Inquiry |
PUF60-4007H | Recombinant Human PUF60 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PUF60-31262TH | Recombinant Human PUF60, His-tagged | +Inquiry |
PUF60-3031C | Recombinant Chicken PUF60 | +Inquiry |
PUF60-8041H | Recombinant Human PUF60 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PUF60-2665HCL | Recombinant Human PUF60 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PUF60 Products
Required fields are marked with *
My Review for All PUF60 Products
Required fields are marked with *
0
Inquiry Basket