Active Recombinant Full Length Human RND3 Protein, C-Flag-tagged

Species :	Human
Source :	Mammalian Cells
Tag :	Flag
Description :	This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Form :	25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity :	Ex vivo tissue treatment
Molecular Mass :	27.2 kDa
AA Sequence :	MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQR IELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLR TDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKS QRATKRISHMPSRPELSAVATDLRKDKAKSCTVMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity :	> 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability :	Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage :	Store at -80 centigrade.
Concentration :	>50 ug/mL as determined by microplate BCA method.
Preparation :	Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length :	Full L.

Gene Name	RND3 Rho family GTPase 3 [ Homo sapiens (human) ]
Official Symbol	RND3
Synonyms	ARHE; Rho8; RhoE; memB
Gene ID	390
mRNA Refseq	NM_005168.5
Protein Refseq	NP_005159.1
MIM	602924
UniProt ID	P61587