Active Recombinant Full Length Human RND3 Protein, C-Flag-tagged
Cat.No. : | RND3-541HFL |
Product Overview : | Recombinant Full Length Human RND3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Ex vivo tissue treatment |
Molecular Mass : | 27.2 kDa |
AA Sequence : | MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQR IELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLR TDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKS QRATKRISHMPSRPELSAVATDLRKDKAKSCTVMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RND3 Rho family GTPase 3 [ Homo sapiens (human) ] |
Official Symbol | RND3 |
Synonyms | ARHE; Rho8; RhoE; memB |
Gene ID | 390 |
mRNA Refseq | NM_005168.5 |
Protein Refseq | NP_005159.1 |
MIM | 602924 |
UniProt ID | P61587 |
◆ Recombinant Proteins | ||
RND3-3919R | Recombinant Rhesus monkey RND3 Protein, His-tagged | +Inquiry |
RND3-2748H | Recombinant Human Rho Family GTPase 3, His-tagged | +Inquiry |
RND3-1895H | Recombinant Human RND3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RND3-541HFL | Active Recombinant Full Length Human RND3 Protein, C-Flag-tagged | +Inquiry |
RND3-3736R | Recombinant Rhesus Macaque RND3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RND3-2312HCL | Recombinant Human RND3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RND3 Products
Required fields are marked with *
My Review for All RND3 Products
Required fields are marked with *
0
Inquiry Basket