Active Recombinant Full Length Human RND3 Protein, C-Flag-tagged

Cat.No. : RND3-541HFL
Product Overview : Recombinant Full Length Human RND3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : Ex vivo tissue treatment
Molecular Mass : 27.2 kDa
AA Sequence : MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQR IELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLR TDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKS
QRATKRISHMPSRPELSAVATDLRKDKAKSCTVMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name RND3 Rho family GTPase 3 [ Homo sapiens (human) ]
Official Symbol RND3
Synonyms ARHE; Rho8; RhoE; memB
Gene ID 390
mRNA Refseq NM_005168.5
Protein Refseq NP_005159.1
MIM 602924
UniProt ID P61587

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RND3 Products

Required fields are marked with *

My Review for All RND3 Products

Required fields are marked with *

0
cart-icon
0
compare icon