Active Recombinant Full Length Human RRM2 Protein, C-Flag-tagged
Cat.No. : | RRM2-137HFL |
Product Overview : | Recombinant Full Length Human RRM2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Binding assay |
Molecular Mass : | 44.7 kDa |
AA Sequence : | MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE PLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGI VNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWA LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL VHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | RRM2 ribonucleotide reductase regulatory subunit M2 [ Homo sapiens (human) ] |
Official Symbol | RRM2 |
Synonyms | R2; RR2; RR2M; C2orf48 |
Gene ID | 6241 |
mRNA Refseq | NM_001034.4 |
Protein Refseq | NP_001025.1 |
MIM | 180390 |
UniProt ID | P31350 |
◆ Recombinant Proteins | ||
RRM2-30111TH | Recombinant Human RRM2, T7 -tagged | +Inquiry |
RRM2-6206H | Recombinant Full Length Human RRM2 Protein (Met1-Phe389), C-His tagged | +Inquiry |
RRM2-1960H | Recombinant Human RRM2 Protein, MYC/DDK-tagged | +Inquiry |
RRM2-1922H | Recombinant Human RRM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RRM2-705H | Recombinant Full Length Human Ribonucleotide Reductase M2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RRM2-1545HCL | Recombinant Human RRM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RRM2 Products
Required fields are marked with *
My Review for All RRM2 Products
Required fields are marked with *
0
Inquiry Basket