| Species : | Human | 
                                
                                    | Source : | Mammalian Cells | 
                                
                                    | Tag : | Flag | 
                                
                                    | Description : | This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. | 
                                
                                    | Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
                                
                                    | Bio-activity : | Binding assay | 
                                
                                    | Molecular Mass : | 44.7 kDa | 
                                
                                    | AA Sequence : | MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE PLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGI VNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWA LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL VHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
 | 
                                
                                    | Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
                                
                                    | Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
                                
                                    | Storage : | Store at -80 centigrade. | 
                                
                                    | Concentration : | >50 ug/mL as determined by microplate BCA method. | 
                                
                                    | Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
                                
                                    | Protein Families : | Druggable Genome | 
                                
                                    | Protein Pathways : | Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism | 
                                
                                    | Full Length : | Full L. |