Active Recombinant Full Length Human RUNX1 Protein, C-Flag-tagged
Cat.No. : | RUNX1-188HFL |
Product Overview : | Recombinant Full Length Human RUNX1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | RUNX1 Activity verified in a DNA-binding assay |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNF LCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMR VSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRA SGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRY HTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Protein Pathways : | Acute myeloid leukemia, Chronic myeloid leukemia, Pathways in cancer |
Full Length : | Full L. |
Gene Name | RUNX1 RUNX family transcription factor 1 [ Homo sapiens (human) ] |
Official Symbol | RUNX1 |
Synonyms | AML1; CBFA2; EVI-1; AMLCR1; PEBP2aB; CBF2alpha; AML1-EVI-1; PEBP2alpha |
Gene ID | 861 |
mRNA Refseq | NM_001001890.3 |
Protein Refseq | NP_001001890.1 |
MIM | 151385 |
UniProt ID | Q01196 |
◆ Recombinant Proteins | ||
RUNX1-9143Z | Recombinant Zebrafish RUNX1 | +Inquiry |
RUNX1-263H | Recombinant Human RUNX1 | +Inquiry |
RUNX1-6780C | Recombinant Chicken RUNX1 | +Inquiry |
RUNX1-188HFL | Active Recombinant Full Length Human RUNX1 Protein, C-Flag-tagged | +Inquiry |
RUNX1-6649H | Recombinant Human RUNX1 Protein (Met1-Tyr480), N-His and SUMO tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RUNX1-2111HCL | Recombinant Human RUNX1 293 Cell Lysate | +Inquiry |
RUNX1-2112HCL | Recombinant Human RUNX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RUNX1 Products
Required fields are marked with *
My Review for All RUNX1 Products
Required fields are marked with *
0
Inquiry Basket