Active Recombinant Full Length Human SNAP25 Protein, C-Flag-tagged
Cat.No. : | SNAP25-136HFL |
Product Overview : | Recombinant Full Length Human SNAP25 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Synaptic vesicle membrane docking and fusion is mediated by SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) located on the vesicle membrane (v-SNAREs) and the target membrane (t-SNAREs). The assembled v-SNARE/t-SNARE complex consists of a bundle of four helices, one of which is supplied by v-SNARE and the other three by t-SNARE. For t-SNAREs on the plasma membrane, the protein syntaxin supplies one helix and the protein encoded by this gene contributes the other two. Therefore, this gene product is a presynaptic plasma membrane protein involved in the regulation of neurotransmitter release. Two alternative transcript variants encoding different protein isoforms have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | MS digestion standard |
Molecular Mass : | 23.2 kDa |
AA Sequence : | MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQD MKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTND ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | SNARE interactions in vesicular transport |
Full Length : | Full L. |
Gene Name | SNAP25 synaptosome associated protein 25 [ Homo sapiens (human) ] |
Official Symbol | SNAP25 |
Synonyms | SUP; RIC4; SEC9; SNAP; CMS18; RIC-4; SNAP-25; bA416N4.2; dJ1068F16.2 |
Gene ID | 6616 |
mRNA Refseq | NM_003081.5 |
Protein Refseq | NP_003072.2 |
MIM | 600322 |
UniProt ID | P60880 |
◆ Recombinant Proteins | ||
SNAP25-296HFL | Recombinant Human SNAP25 Protein, Full Length, N-His tagged | +Inquiry |
SNAP25-136HFL | Active Recombinant Full Length Human SNAP25 Protein, C-Flag-tagged | +Inquiry |
SNAP25-297H | Recombinant Human SNAP25 Protein, His-tagged | +Inquiry |
Snap25-5992M | Recombinant Mouse Snap25 Protein, Myc/DDK-tagged | +Inquiry |
SNAP25-7008C | Recombinant Chicken SNAP25 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNAP25-1640HCL | Recombinant Human SNAP25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAP25 Products
Required fields are marked with *
My Review for All SNAP25 Products
Required fields are marked with *
0
Inquiry Basket