Active Recombinant Full Length Human SRP54 Protein, C-Flag-tagged
Cat.No. : | SRP54-388HFL |
Product Overview : | Recombinant Full Length Human SRP54 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | ELISA capture for autoantibodies |
Molecular Mass : | 55.5 kDa |
AA Sequence : | MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLN KRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTF RAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVAN AIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHID DFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILG MIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQEL LTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQG AAGNMKGMMGFNNMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Protein export |
Full Length : | Full L. |
Gene Name | SRP54 signal recognition particle 54 [ Homo sapiens (human) ] |
Official Symbol | SRP54 |
Synonyms | SCN8 |
Gene ID | 6729 |
mRNA Refseq | NM_003136.4 |
Protein Refseq | NP_003127.1 |
MIM | 604857 |
UniProt ID | P61011 |
◆ Recombinant Proteins | ||
SRP54-0433H | Recombinant Human SRP54 Protein (Asn2-Met504), N-His-tagged | +Inquiry |
SRP54-4284R | Recombinant Rhesus Macaque SRP54 Protein, His (Fc)-Avi-tagged | +Inquiry |
SRP54-2742H | Recombinant Human SRP54 Protein, MYC/DDK-tagged | +Inquiry |
SRP54-720C | Recombinant Cynomolgus Monkey SRP54 Protein, His (Fc)-Avi-tagged | +Inquiry |
SRP54-5401R | Recombinant Rat SRP54 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRP54-632HCL | Recombinant Human SRP54 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRP54 Products
Required fields are marked with *
My Review for All SRP54 Products
Required fields are marked with *
0
Inquiry Basket