Active Recombinant Full Length Human SRPK3 Protein, C-Flag-tagged

Cat.No. : SRPK3-997HFL
Product Overview : Recombinant Full Length Human SRPK3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a protein kinase similar to a protein kinase which is specific for the SR (serine/arginine-rich domain) family of splicing factors. A highly similar protein has been shown to play a role in muscle development in mice. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : SRPK3 activity verified in a biochemical assay: SRPK3 (SRSF protein kinase 3) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. SRPK3 is a serine/threonine kinase similar to a protein kinase which is specific for the SR (serine/arginine-rich domain) family of splicing factors. Varying concentrations of SRPK3 were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors.
Molecular Mass : 61.8 kDa
AA Sequence : MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATPVPQMLQGLLGSDDEEQEDPKDYCKGGYHPVK IGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKR ETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIH TDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKR LLEERLRDLQRLEAMEAATQAEDSGLRLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQT SGFSGSLFSPASCSILSGSSNQRETGGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHF TEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPP AFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCL
QHPWLNPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Protein Kinase
Full Length : Full L.
Gene Name SRPK3 SRSF protein kinase 3 [ Homo sapiens (human) ]
Official Symbol SRPK3
Synonyms MSSK1; STK23; MSSK-1
Gene ID 26576
mRNA Refseq NM_014370.4
Protein Refseq NP_055185.2
MIM 301002
UniProt ID Q9UPE1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRPK3 Products

Required fields are marked with *

My Review for All SRPK3 Products

Required fields are marked with *

0
cart-icon