Active Recombinant Full Length Human SRR Protein, C-Flag-tagged
| Cat.No. : | SRR-1114HFL |
| Product Overview : | Recombinant Full Length Human SRR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables several functions, including L-serine ammonia-lyase activity; PDZ domain binding activity; and anion binding activity. Involved in pyruvate biosynthetic process; response to lipopolysaccharide; and serine family amino acid metabolic process. Located in cytoplasm and neuronal cell body. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | SRR Facilitates D-serine Production from L-serine: In vitro assays, Purified human SRR converts L-serine to D-serine in a dose and time dependent manner. Y-axis is pmol of D-serine produced. |
| Molecular Mass : | 36.4 kDa |
| AA Sequence : | MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPD ALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAK RVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAE PSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKL LIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Pathways : | Glycine, serine and threonine metabolism |
| Full Length : | Full L. |
| Gene Name | SRR serine racemase [ Homo sapiens (human) ] |
| Official Symbol | SRR |
| Synonyms | ILV1; ISO1 |
| Gene ID | 63826 |
| mRNA Refseq | NM_021947.3 |
| Protein Refseq | NP_068766.1 |
| MIM | 606477 |
| UniProt ID | Q9GZT4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRR Products
Required fields are marked with *
My Review for All SRR Products
Required fields are marked with *



