Active Recombinant Full Length Human SRR Protein, C-Flag-tagged

Cat.No. : SRR-1114HFL
Product Overview : Recombinant Full Length Human SRR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables several functions, including L-serine ammonia-lyase activity; PDZ domain binding activity; and anion binding activity. Involved in pyruvate biosynthetic process; response to lipopolysaccharide; and serine family amino acid metabolic process. Located in cytoplasm and neuronal cell body.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : SRR Facilitates D-serine Production from L-serine: In vitro assays, Purified human SRR converts L-serine to D-serine in a dose and time dependent manner. Y-axis is pmol of D-serine produced.
Molecular Mass : 36.4 kDa
AA Sequence : MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPD ALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAK RVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAE PSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKL
LIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Glycine, serine and threonine metabolism
Full Length : Full L.
Gene Name SRR serine racemase [ Homo sapiens (human) ]
Official Symbol SRR
Synonyms ILV1; ISO1
Gene ID 63826
mRNA Refseq NM_021947.3
Protein Refseq NP_068766.1
MIM 606477
UniProt ID Q9GZT4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRR Products

Required fields are marked with *

My Review for All SRR Products

Required fields are marked with *

0
cart-icon