Active Recombinant Full Length Human STK38 Protein, C-Flag-tagged
| Cat.No. : | STK38-265HFL |
| Product Overview : | Recombinant Full Length Human STK38 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a member of the AGC serine/threonine kinase family of proteins. The kinase activity of this protein is regulated by autophosphorylation and phosphorylation by other upstream kinases. This protein has been shown to function in the cell cycle and apoptosis. This protein has also been found to regulate the protein stability and transcriptional activity of the MYC oncogene. Alternative splicing results in multiple transcript variants. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | In vitro ubiquitination assay (regulator) Pull-down assay |
| Molecular Mass : | 54 kDa |
| AA Sequence : | MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHA RKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDI LVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIH RDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAF STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPIS EKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK PTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAKSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Protein Kinase |
| Full Length : | Full L. |
| Gene Name | STK38 serine/threonine kinase 38 [ Homo sapiens (human) ] |
| Official Symbol | STK38 |
| Synonyms | NDR; NDR1 |
| Gene ID | 11329 |
| mRNA Refseq | NM_007271.4 |
| Protein Refseq | NP_009202.1 |
| MIM | 606964 |
| UniProt ID | Q15208 |
| ◆ Recombinant Proteins | ||
| STK38-2126H | Recombinant Human STK38 Protein, His (Fc)-Avi-tagged | +Inquiry |
| STK38-4528R | Recombinant Rhesus monkey STK38 Protein, His-tagged | +Inquiry |
| STK38-1179H | Recombinant Human Serine/Threonine Kinase 38, His-tagged | +Inquiry |
| Stk38-300M | Recombinant Mouse Stk38 Protein, MYC/DDK-tagged | +Inquiry |
| STK38-265HFL | Active Recombinant Full Length Human STK38 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STK38-1400HCL | Recombinant Human STK38 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STK38 Products
Required fields are marked with *
My Review for All STK38 Products
Required fields are marked with *
