Active Recombinant Full Length Human TMEM98 Protein, C-Flag-tagged
Cat.No. : | TMEM98-437HFL |
Product Overview : | Recombinant Full Length Human TMEM98 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 24.4 kDa |
AA Sequence : | METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVIT NPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVD DVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPD KGLPGPEGFLQEQSAITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | TMEM98 transmembrane protein 98 [ Homo sapiens (human) ] |
Official Symbol | TMEM98 |
Synonyms | TADA1 |
Gene ID | 26022 |
mRNA Refseq | NM_015544.3 |
Protein Refseq | NP_056359.2 |
MIM | 615949 |
UniProt ID | Q9Y2Y6 |
◆ Recombinant Proteins | ||
TMEM98-3593H | Recombinant Human TMEM98 protein, His-tagged | +Inquiry |
Tmem98-235M | Recombinant Mouse Tmem98 Protein, MYC/DDK-tagged | +Inquiry |
TMEM98-437HFL | Active Recombinant Full Length Human TMEM98 Protein, C-Flag-tagged | +Inquiry |
TMEM98-5838R | Recombinant Rat TMEM98 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM98-17098M | Recombinant Mouse TMEM98 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM98-922HCL | Recombinant Human TMEM98 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM98 Products
Required fields are marked with *
My Review for All TMEM98 Products
Required fields are marked with *