Active Recombinant Full Length Human TSPO Protein, C-Flag-tagged

• Cat.No.: TSPO-142HFL
• Product Overview: Recombinant Full Length Human TSPO Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Surface Plasmon Ressonance (SPR)
• Molecular Mass: 18.6 kDa
• AA Sequence: MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKE LGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPY
  LAWLAFATTLNYCVWRDNHGWHGGRRLPETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction
• Full Length: Full L.

Gene Information

• Gene Name: TSPO translocator protein [ Homo sapiens (human) ]
• Official Symbol: TSPO
• Synonyms: DBI; IBP; MBR; PBR; PBS; BPBS; BZRP; PKBS; PTBR; mDRC; pk18; TSPO1
• Gene ID: 706
• mRNA Refseq: NM_000714.6
• Protein Refseq: NP_000705.2
• MIM: 109610
• UniProt ID: P30536