Active Recombinant Full Length Human TSSK1B Protein, C-Flag-tagged
Cat.No. : | TSSK1B-869HFL |
Product Overview : | Recombinant Full Length Human TSSK1B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | TSSK1 belongs to a family of serine/threonine kinases highly expressed in testis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | TSSK1B activity verified in a biochemical assay: TSSK1B (testis-specific serine kinase 1B) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. TSSK1B is a serine/threonine kinase that is highly expressed in testis and may be involved in a signaling pathway during male germ cell development or mature sperm function. Varying concentrations of TSSK1B were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
Molecular Mass : | 41.4 kDa |
AA Sequence : | MDDAAVLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPADFLEKFLPREIEILAMLNHC SIIKTYEIFETSHGKVYIVMELAVQGDLLELIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCD NLLLDKDFNIKLSDFSFSKRCLRDDSGRMALSKTFCGSPAYAAPEVLQGIPYQPKVYDIWSLGVILYIMV CGSMPYDDSNIKKMLRIQKEHRVNFPRSKHLTGECKDLIYHMLQPDVNRRLHIDEILSHCWMQPKARGSP SVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPST METEEGPPQQPPETRAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Full Length : | Full L. |
Gene Name | TSSK1B testis specific serine kinase 1B [ Homo sapiens (human) ] |
Official Symbol | TSSK1B |
Synonyms | TSK1; TSSK1; FKSG81; SPOGA4; STK22D |
Gene ID | 83942 |
mRNA Refseq | NM_032028.4 |
Protein Refseq | NP_114417.1 |
MIM | 610709 |
UniProt ID | Q9BXA7 |
◆ Recombinant Proteins | ||
TSSK1B-1250H | Recombinant Human TSSK1B Protein (D2-Q367), GST tagged | +Inquiry |
TSSK1B-1113H | Recombinant Human Testis-Specific Serine Kinase 1B, GST-tagged | +Inquiry |
TSSK1B-869HFL | Active Recombinant Full Length Human TSSK1B Protein, C-Flag-tagged | +Inquiry |
TSSK1B-179HFL | Active Recombinant Full Length Human TSSK1B Protein, N-His-tagged | +Inquiry |
TSSK1B-2268H | Recombinant Human TSSK1B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSSK1B-694HCL | Recombinant Human TSSK1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSSK1B Products
Required fields are marked with *
My Review for All TSSK1B Products
Required fields are marked with *
0
Inquiry Basket