Active Recombinant Full Length Human TTC33 Protein, C-Flag-tagged
Cat.No. : | TTC33-625HFL |
Product Overview : | Recombinant Full Length Human TTC33 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | TTC33 (Tetratricopeptide Repeat Domain 33) is a Protein Coding gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme substrate |
Molecular Mass : | 29.2 kDa |
AA Sequence : | MASFGWKRKIGEKVSKVTSQQFEAEAADEKDVVDNDEGNWLHAIKRRKEILLEGCAEKSKQLKDEGASLA ENKRYREAIQKWDEALQLTPNDATLYEMKSQVLMSLHEMFPAVHAAEMAVQQNPHSWESWQTLGRAQLGL GEIILAIRSFQVALHIYPMNPEIWKEDLSWARTLQEQQKVAQRIKKSEAPAEVTHFSPKSIPDYDFESDE IVAVCAAIAEKEKTVSANKTMVIVSASGAIETVTEKEDGATPPDGSVFIKARTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TTC33 tetratricopeptide repeat domain 33 [ Homo sapiens (human) ] |
Official Symbol | TTC33 |
Synonyms | OSRF |
Gene ID | 23548 |
mRNA Refseq | NM_012382.3 |
Protein Refseq | NP_036514.1 |
UniProt ID | Q6PID6 |
◆ Recombinant Proteins | ||
TTC33-9721M | Recombinant Mouse TTC33 Protein, His (Fc)-Avi-tagged | +Inquiry |
TTC33-4830R | Recombinant Rhesus Macaque TTC33 Protein, His (Fc)-Avi-tagged | +Inquiry |
TTC33-17565M | Recombinant Mouse TTC33 Protein | +Inquiry |
TTC33-2271H | Recombinant Human TTC33 Protein, His (Fc)-Avi-tagged | +Inquiry |
TTC33-5016R | Recombinant Rhesus monkey TTC33 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTC33-678HCL | Recombinant Human TTC33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TTC33 Products
Required fields are marked with *
My Review for All TTC33 Products
Required fields are marked with *
0
Inquiry Basket