Active Recombinant Full Length Human TTC33 Protein, C-Flag-tagged
| Cat.No. : | TTC33-625HFL |
| Product Overview : | Recombinant Full Length Human TTC33 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | TTC33 (Tetratricopeptide Repeat Domain 33) is a Protein Coding gene. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | Enzyme substrate |
| Molecular Mass : | 29.2 kDa |
| AA Sequence : | MASFGWKRKIGEKVSKVTSQQFEAEAADEKDVVDNDEGNWLHAIKRRKEILLEGCAEKSKQLKDEGASLA ENKRYREAIQKWDEALQLTPNDATLYEMKSQVLMSLHEMFPAVHAAEMAVQQNPHSWESWQTLGRAQLGL GEIILAIRSFQVALHIYPMNPEIWKEDLSWARTLQEQQKVAQRIKKSEAPAEVTHFSPKSIPDYDFESDE IVAVCAAIAEKEKTVSANKTMVIVSASGAIETVTEKEDGATPPDGSVFIKARTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | TTC33 tetratricopeptide repeat domain 33 [ Homo sapiens (human) ] |
| Official Symbol | TTC33 |
| Synonyms | OSRF |
| Gene ID | 23548 |
| mRNA Refseq | NM_012382.3 |
| Protein Refseq | NP_036514.1 |
| UniProt ID | Q6PID6 |
| ◆ Recombinant Proteins | ||
| TTC33-4830R | Recombinant Rhesus Macaque TTC33 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ttc33-6710M | Recombinant Mouse Ttc33 Protein, Myc/DDK-tagged | +Inquiry |
| TTC33-5016R | Recombinant Rhesus monkey TTC33 Protein, His-tagged | +Inquiry |
| TTC33-3707H | Recombinant Human TTC33 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TTC33-2271H | Recombinant Human TTC33 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TTC33-678HCL | Recombinant Human TTC33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTC33 Products
Required fields are marked with *
My Review for All TTC33 Products
Required fields are marked with *
