Active Recombinant Full Length Human TUBB3 Protein, C-Flag-tagged
Cat.No. : | TUBB3-203HFL |
Product Overview : | Recombinant Full Length Human TUBB3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Co-immunoprecipitation |
Molecular Mass : | 50.3 kDa |
AA Sequence : | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEP GTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLG GGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDI CFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQ YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVK VAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS EYQQYQDATAEEEGEMYEDDEEESEAQGPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS |
Protein Pathways : | Gap junction, Pathogenic Escherichia coli infection |
Full Length : | Full L. |
Gene Name | TUBB3 tubulin beta 3 class III [ Homo sapiens (human) ] |
Official Symbol | TUBB3 |
Synonyms | CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A |
Gene ID | 10381 |
mRNA Refseq | NM_006086.4 |
Protein Refseq | NP_006077.2 |
MIM | 602661 |
UniProt ID | Q13509 |
◆ Recombinant Proteins | ||
TUBB3-5059H | Recombinant Human TUBB3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TUBB3-6744H | Recombinant Human TUBB3 protein, GST-tagged | +Inquiry |
TUBB3-3238C | Recombinant Chicken TUBB3 | +Inquiry |
TUBB3-0505H | Recombinant Human TUBB3 protein, His-tagged | +Inquiry |
TUBB3-5530H | Recombinant Human TUBB3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBB3-648HCL | Recombinant Human TUBB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUBB3 Products
Required fields are marked with *
My Review for All TUBB3 Products
Required fields are marked with *
0
Inquiry Basket