| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-158 aa |
| Description : |
The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. |
| Form : |
Liquid |
| AASequence : |
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH |
| Molecular Mass : |
20.1 kDa (178aa) confirmed by MALDI-TOF |
| Bio-activity : |
Specific activity is > 15,000 unit/mg, and is defined as the amount of enzyme that hydrolyze 1.0 nmole of p-nitrophenyl phosphate (pNPP) per minute at pH 7.5 at 37 centigrade. |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 95% as determined by SDS-PAGE |
| Application : |
SDS-PAGE, Enzyme Activity |
| Note : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : |
20mM MES buffer (pH 6.0) containing 0.1mM PMSF, 2mM EDTA, 10% glycerol |
| Concentration : |
1 mg/mL (determined by Bradford assay) |
