Active Recombinant Human ACVR1, Fc-tagged, Biotinylated
Cat.No. : | ACVR1-526H |
Product Overview : | The recombinant human ACVR1-Fc fusion protein is expressed as a 331amino acid protein consisting of Met21 - Glu123 region of ACVR1 (UniProt accession #Q04771) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 21-123 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized ACVR1 protein binds human BMP6 in a functional ELISA. Blocks BMP6-mediated signaling activity. |
Molecular Mass : | Calculated molecular mass (kDa): 37.1; Estimated by SDS-PAGE under reducing condition (kDa): ~45 |
AA Sequence : | MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECC QGDWCNRNITAQLPTKGKSFPGTQNFHLESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Publications : |
An anti-ACVR1 antibody exacerbates heterotopic ossification by fibro/adipogenic progenitors in fibrodysplasia ossificans progressiva mice (2021)
|
Gene Name | ACVR1 activin A receptor, type I [ Homo sapiens ] |
Official Symbol | ACVR1 |
Synonyms | ACVR1; activin A receptor, type I; ACVRLK2; activin receptor type-1; ACVR1A; ALK2; SKR1; activin receptor type I; hydroxyalkyl-protein kinase; activin receptor-like kinase 2; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; FOP; TSRI; ACTRI; |
Gene ID | 90 |
mRNA Refseq | NM_001105 |
Protein Refseq | NP_001096 |
MIM | 102576 |
UniProt ID | Q04771 |
Chromosome Location | 2q23-q24 |
Pathway | ALK1 pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
Function | ATP binding; SMAD binding; activin binding; contributes_to activin receptor activity, type I; follistatin binding; metal ion binding; nucleotide binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transmembrane receptor protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
ACVR1-1583H | Recombinant Human Activin A Receptor, Type I | +Inquiry |
ACVR1-01H | Recombinant Human Activin A Receptor, Type I | +Inquiry |
ACVR1-300C | Recombinant Canine ACVR1, His tagged | +Inquiry |
Acvr1-5682M | Recombinant Mouse Acvr1 protein, His-tagged | +Inquiry |
ACVR1-247H | Recombinant Human ACVR1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR1-478HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
ACVR1-2686MCL | Recombinant Mouse ACVR1 cell lysate | +Inquiry |
ACVR1-1232CCL | Recombinant Cynomolgus ACVR1 cell lysate | +Inquiry |
ACVR1-3097HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
ACVR1-1305RCL | Recombinant Rat ACVR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACVR1 Products
Required fields are marked with *
My Review for All ACVR1 Products
Required fields are marked with *
0
Inquiry Basket