Active Recombinant Human ACVRL1, Fc-tagged, Biotinylated
Cat.No. : | ACVRL1-534H |
Product Overview : | The recombinant humanACVRL1-Fc fusion protein is expressed as a 325 amino acid protein consisting of Asp22 - Gln118 region of ACVRL1 (UniProt accession #P37023) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 22-118 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized ACVRL1/ALK1 protein binds human BMP9 in a functional ELISA. Inhibits BMP9-induced alkaline phosphatase production by chondrogenic cells. |
Molecular Mass : | Calculated molecular mass (kDa): 36.3; Estimated by SDS-PAGE under reducing condition (kDa): ~50 |
AA Sequence : | DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLC NHNVSLVLEATQPPSEQPGTDGQSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | ACVRL1 activin A receptor type II-like 1 [ Homo sapiens ] |
Official Symbol | ACVRL1 |
Synonyms | ACVRL1; activin A receptor type II-like 1; ACVRLK1, ORW2; serine/threonine-protein kinase receptor R3; ALK1; HHT; HHT2; activin receptor-like kinase 1; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 1; ORW2; SKR3; ALK-1; TSR-I; ACVRLK1; |
Gene ID | 94 |
mRNA Refseq | NM_000020 |
Protein Refseq | NP_000011 |
MIM | 601284 |
UniProt ID | P37023 |
Chromosome Location | 12q11-q14 |
Pathway | ALK1 pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem; |
Function | ATP binding; SMAD binding; activin binding; activin receptor activity, type I; contributes_to activin receptor activity, type I; metal ion binding; nucleotide binding; protein binding; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; contributes_to transforming growth factor beta receptor activity, type I; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
ACVRL1-0653H | Recombinant Human ACVRL1 Protein (Met1-Ser392), C-His-tagged | +Inquiry |
ACVRL1-9455Z | Recombinant Zebrafish ACVRL1 | +Inquiry |
ACVRL1-5332H | Recombinant Human ACVRL1 Protein (Met1-Gln118), C-Fc tagged | +Inquiry |
ACVRL1-534H | Active Recombinant Human ACVRL1, Fc-tagged, Biotinylated | +Inquiry |
Acvrl1-2333M | Active Recombinant Mouse Acvrl1 protein(Met1-Pro119), His&hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVRL1-994CCL | Recombinant Canine ACVRL1 cell lysate | +Inquiry |
ACVRL1-3093MCL | Recombinant Mouse ACVRL1 cell lysate | +Inquiry |
ACVRL1-2629HCL | Recombinant Human ACVRL1 cell lysate | +Inquiry |
ACVRL1-1191CCL | Recombinant Cynomolgus ACVRL1 cell lysate | +Inquiry |
ACVRL1-3001RCL | Recombinant Rat ACVRL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACVRL1 Products
Required fields are marked with *
My Review for All ACVRL1 Products
Required fields are marked with *
0
Inquiry Basket