Active Recombinant Human ACVRL1, Fc-tagged, Biotinylated

Cat.No. : ACVRL1-534H
Product Overview : The recombinant humanACVRL1-Fc fusion protein is expressed as a 325 amino acid protein consisting of Asp22 - Gln118 region of ACVRL1 (UniProt accession #P37023) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 22-118 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized ACVRL1/ALK1 protein binds human BMP9 in a functional ELISA. Inhibits BMP9-induced alkaline phosphatase production by chondrogenic cells.
Molecular Mass : Calculated molecular mass (kDa): 36.3; Estimated by SDS-PAGE under reducing condition (kDa): ~50
AA Sequence : DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLC NHNVSLVLEATQPPSEQPGTDGQSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Conjugation : Biotin
Gene Name ACVRL1 activin A receptor type II-like 1 [ Homo sapiens ]
Official Symbol ACVRL1
Synonyms ACVRL1; activin A receptor type II-like 1; ACVRLK1, ORW2; serine/threonine-protein kinase receptor R3; ALK1; HHT; HHT2; activin receptor-like kinase 1; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 1; ORW2; SKR3; ALK-1; TSR-I; ACVRLK1;
Gene ID 94
mRNA Refseq NM_000020
Protein Refseq NP_000011
MIM 601284
UniProt ID P37023
Chromosome Location 12q11-q14
Pathway ALK1 pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem;
Function ATP binding; SMAD binding; activin binding; activin receptor activity, type I; contributes_to activin receptor activity, type I; metal ion binding; nucleotide binding; protein binding; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; contributes_to transforming growth factor beta receptor activity, type I; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACVRL1 Products

Required fields are marked with *

My Review for All ACVRL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon