Active Recombinant Human ANGPTL3 protein, His-tagged
| Cat.No. : | ANGPTL3-555H |
| Product Overview : | Human ANGPTL3 (Q9Y5C1) partial recombinant protein with His tag expressed in CHO cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Hamster |
| Tag : | His |
| Description : | This gene encodes a member of a family of secreted proteins that function in angiogenesis. The encoded protein, which is expressed predominantly in the liver, is further processed into an N-terminal coiled-coil domain-containing chain and a C-terminal fibrinogen chain. The N-terminal chain is important for lipid metabolism, while the C-terminal chain may be involved in angiogenesis. Mutations in this gene cause familial hypobetalipoproteinemia type 2. [provided by RefSeq, Aug 2015] |
| Form : | Lyophilized |
| Bio-activity : | Measured by its binding ability to recombinant alpha-v beta-3 integrin in a functional ELISA. |
| Molecular Mass : | 62 kDa |
| AA Sequence : | SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEHHHHHHHH |
| Endotoxin : | Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug). |
| Purity : | 98% |
| Applications : | Functional Study; SDS-PAGE |
| Usage : | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage : | Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Gene Name | ANGPTL3 angiopoietin-like 3 [ Homo sapiens ] |
| Official Symbol | ANGPTL3 |
| Synonyms | ANGPTL3; angiopoietin-like 3; ANGPT5; angiopoietin-related protein 3; angiopoietin 5; ANG-5; FHBL2; |
| Gene ID | 27329 |
| mRNA Refseq | NM_014495 |
| Protein Refseq | NP_055310 |
| MIM | 604774 |
| UniProt ID | Q9Y5C1 |
| ◆ Recombinant Proteins | ||
| Angptl3-1626M | Recombinant Mouse Angptl3 Protein, Myc/DDK-tagged | +Inquiry |
| ANGPTL3-26574TH | Recombinant Human ANGPTL3, FLAG-tagged | +Inquiry |
| ANGPTL3-1227HF | Recombinant Full Length Human ANGPTL3 Protein, GST-tagged | +Inquiry |
| ANGPTL3-398M | Recombinant Mouse ANGPTL3, Coiled-Coil Domain, His-tagged | +Inquiry |
| ANGPTL3-9329Z | Recombinant Zebrafish ANGPTL3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANGPTL3-8862HCL | Recombinant Human ANGPTL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPTL3 Products
Required fields are marked with *
My Review for All ANGPTL3 Products
Required fields are marked with *



