Active Recombinant Human ANGPTL3 protein, His-tagged
Cat.No. : | ANGPTL3-555H |
Product Overview : | Human ANGPTL3 (Q9Y5C1) partial recombinant protein with His tag expressed in CHO cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Hamster |
Tag : | His |
Description : | This gene encodes a member of a family of secreted proteins that function in angiogenesis. The encoded protein, which is expressed predominantly in the liver, is further processed into an N-terminal coiled-coil domain-containing chain and a C-terminal fibrinogen chain. The N-terminal chain is important for lipid metabolism, while the C-terminal chain may be involved in angiogenesis. Mutations in this gene cause familial hypobetalipoproteinemia type 2. [provided by RefSeq, Aug 2015] |
Form : | Lyophilized |
Bio-activity : | Measured by its binding ability to recombinant alpha-v beta-3 integrin in a functional ELISA. |
Molecular Mass : | 62 kDa |
AA Sequence : | SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEHHHHHHHH |
Endotoxin : | Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug). |
Purity : | 98% |
Applications : | Functional Study; SDS-PAGE |
Usage : | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage : | Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
Gene Name | ANGPTL3 angiopoietin-like 3 [ Homo sapiens ] |
Official Symbol | ANGPTL3 |
Synonyms | ANGPTL3; angiopoietin-like 3; ANGPT5; angiopoietin-related protein 3; angiopoietin 5; ANG-5; FHBL2; |
Gene ID | 27329 |
mRNA Refseq | NM_014495 |
Protein Refseq | NP_055310 |
MIM | 604774 |
UniProt ID | Q9Y5C1 |
◆ Recombinant Proteins | ||
ANGPTL3-399H | Recombinant Human ANGPTL3 Protein, FLAG-tagged | +Inquiry |
ANGPTL3-101H | Recombinant Human ANGPTL3, His-tagged | +Inquiry |
ANGPTL3-1420C | Recombinant Cynomolgus ANGPTL3 protein, His-tagged | +Inquiry |
ANGPTL3-2890H | Active Recombinant Human ANGPTL3 protein, His-Avi-tagged, Biotinylated | +Inquiry |
ANGPTL3-178C | Recombinant Cynomolgus ANGPTL3 protein (Met1-Pro220), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPTL3-8862HCL | Recombinant Human ANGPTL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANGPTL3 Products
Required fields are marked with *
My Review for All ANGPTL3 Products
Required fields are marked with *
0
Inquiry Basket