Active Recombinant Human ANGPTL3 protein, His-tagged

• Cat.No.: ANGPTL3-555H
• Product Overview: Human ANGPTL3 (Q9Y5C1) partial recombinant protein with His tag expressed in CHO cells.

Specification

• Species: Human
• Source: Hamster
• Tag: His
• Description: This gene encodes a member of a family of secreted proteins that function in angiogenesis. The encoded protein, which is expressed predominantly in the liver, is further processed into an N-terminal coiled-coil domain-containing chain and a C-terminal fibrinogen chain. The N-terminal chain is important for lipid metabolism, while the C-terminal chain may be involved in angiogenesis. Mutations in this gene cause familial hypobetalipoproteinemia type 2. [provided by RefSeq, Aug 2015]
• Form: Lyophilized
• Bio-activity: Measured by its binding ability to recombinant alpha-v beta-3 integrin in a functional ELISA.
• Molecular Mass: 62 kDa
• AA Sequence: SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEHHHHHHHH
• Endotoxin: Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
• Purity: 98%
• Applications: Functional Study; SDS-PAGE
• Usage: Activity assay
  SDS-PAGE
  The optimal working dilution should be determined by the end user.
• Storage: Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein

Gene Information

• Gene Name: ANGPTL3 angiopoietin-like 3 [ Homo sapiens ]
• Official Symbol: ANGPTL3
• Synonyms: ANGPTL3; angiopoietin-like 3; ANGPT5; angiopoietin-related protein 3; angiopoietin 5; ANG-5; FHBL2
• Gene ID: 27329
• mRNA Refseq: NM_014495
• Protein Refseq: NP_055310
• MIM: 604774
• UniProt ID: Q9Y5C1