Active Recombinant Human ATP1B2 Protein, His-tagged

Cat.No. : ATP1B2-18H
Product Overview : Recombinant human ATP1B2 (68-290aa, 232aa), fused to His-tag at Cterminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability September 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 68-290
Description : The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. Two transcript variants encoding different isoforms have been found for this gene.
Form : Liquid
Bio-activity : Specific activity is > 3,000 pmol/min/μg, and is defined as the amount of enzyme that hydrolyze 1.0 pmole of Adenosine 5-triphosphate to phosphate per minute per minute at pH 7.5 at 25 centigrade.
Molecular Mass : 26.4 kDa
AA Sequence : DHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Enzyme Activity
Storage : Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name ATP1B2 ATPase Na+/K+ transporting subunit beta 2 [ Homo sapiens (human) ]
Official Symbol ATP1B2
Synonyms ATP1B2; ATPase Na+/K+ transporting subunit beta 2; AMOG; sodium/potassium-transporting ATPase subunit beta-2; ATPase, Na+/K+ transporting, beta 2 polypeptide; Na, K-ATPase beta-2 polypeptide; adhesion molecule in glia; adhesion molecule on glia; sodium pump subunit beta-2; sodium-potassium ATPase subunit beta 2 (non-catalytic); sodium/potassium-dependent ATPase beta-2 subunit; sodium/potassium-dependent ATPase subunit beta-2; sodium/potassium-transporting ATPase beta-2 chain; EC 7.2.2.13
Gene ID 482
mRNA Refseq NM_001678
Protein Refseq NP_001669
MIM 182331
UniProt ID P14415

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP1B2 Products

Required fields are marked with *

My Review for All ATP1B2 Products

Required fields are marked with *

0
cart-icon
0
compare icon