Active Recombinant Human BRSK1 Protein, GST-tagged

Cat.No. : BRSK1-349H
Product Overview : Human BRSK1 partial ORF ( NP_115806, 289 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Bio-activity : The activity was measured by off-chip mobility shift assay. The enzyme was incubated with fluorescence-labeled substrate and Mg(or Mn)/ATP. SubstrateThe phosphorylated and unphosphorylated substrates were separated and detected by LabChip 3000. Substrate: CHKtide. ATP: 100 uM.
Molecular Mass : 35.86 kDa
AA Sequence : KHEPDPCLEPAPGRRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKERYPSCEDQDLPPRNDVDPPRK
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BRSK1 BR serine/threonine kinase 1 [ Homo sapiens ]
Official Symbol BRSK1
Synonyms BRSK1; BR serine/threonine kinase 1; serine/threonine-protein kinase BRSK1; KIAA1811; SAD1 kinase; SAD1 homolog; protein kinase SAD1A; brain-selective kinase 1; SadB kinase short isoform; BR serine/threonine-protein kinase 1; serine/threonine-protein kinase SAD-B; synapses of Amphids Defective homolog 1; brain-specific serine/threonine-protein kinase 1; hSAD1; FLJ43009;
Gene ID 84446
mRNA Refseq NM_032430
Protein Refseq NP_115806
MIM 609235
UniProt ID Q8TDC3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRSK1 Products

Required fields are marked with *

My Review for All BRSK1 Products

Required fields are marked with *

0
cart-icon