Active Recombinant Human BRSK1 Protein, GST-tagged
Cat.No. : | BRSK1-349H |
Product Overview : | Human BRSK1 partial ORF ( NP_115806, 289 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Bio-activity : | The activity was measured by off-chip mobility shift assay. The enzyme was incubated with fluorescence-labeled substrate and Mg(or Mn)/ATP. SubstrateThe phosphorylated and unphosphorylated substrates were separated and detected by LabChip 3000. Substrate: CHKtide. ATP: 100 uM. |
Molecular Mass : | 35.86 kDa |
AA Sequence : | KHEPDPCLEPAPGRRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKERYPSCEDQDLPPRNDVDPPRK |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BRSK1 BR serine/threonine kinase 1 [ Homo sapiens ] |
Official Symbol | BRSK1 |
Synonyms | BRSK1; BR serine/threonine kinase 1; serine/threonine-protein kinase BRSK1; KIAA1811; SAD1 kinase; SAD1 homolog; protein kinase SAD1A; brain-selective kinase 1; SadB kinase short isoform; BR serine/threonine-protein kinase 1; serine/threonine-protein kinase SAD-B; synapses of Amphids Defective homolog 1; brain-specific serine/threonine-protein kinase 1; hSAD1; FLJ43009; |
Gene ID | 84446 |
mRNA Refseq | NM_032430 |
Protein Refseq | NP_115806 |
MIM | 609235 |
UniProt ID | Q8TDC3 |
◆ Recombinant Proteins | ||
BRSK1-1020R | Recombinant Rat BRSK1 Protein | +Inquiry |
BRSK1-348H | Recombinant Human BRSK1 Protein, GST-tagged | +Inquiry |
BRSK1-5370H | Recombinant Human BR Serine/Threonine Kinase 1, GST-tagged | +Inquiry |
BRSK1-1369M | Active Recombinant Mouse BRSK1, GST-tagged | +Inquiry |
BRSK1-27740TH | Recombinant Human BRSK1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRSK1 Products
Required fields are marked with *
My Review for All BRSK1 Products
Required fields are marked with *