Species : |
Human |
Source : |
HEK293 |
Tag : |
His |
Protein Length : |
86 |
Description : |
This gene encodes a member of the epidermal growth factor (EGF) family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the secreted growth factor. A secreted form and a membrane-anchored form of this protein bind to multiple different EGF receptors. This protein promotes pancreatic cell proliferation and insulin secretion, as well as retinal vascular permeability. Mutations in this gene may be associated with type 2 diabetes in human patients. |
Form : |
Liquid |
Bio-activity : |
Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 range ≤ 0.5 ng/mL. |
Molecular Mass : |
9.8 kDa |
AA Sequence : |
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY |
Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
Purity : |
> 95% by SDS-PAGE |
Applications : |
SDS-PAGE, Bioactivity |
Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : |
0.25 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol. |