Active Recombinant Human CADM3, Fc-tagged
Cat.No. : | CADM3-645H |
Product Overview : | The recombinant human NECL1-Fc fusion protein is expressed as a 535-amino acid protein consisting of Asn25 - Ala331 region of NECL1 (UniProt accession #Q8N126) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 25-331 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
Bio-activity : | Immobilized NECL1 protein supports the adhesion of C6 rat brain glial cells and enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons |
Molecular Mass : | Calculated molecular mass (kDa): 59.3; Estimated by SDS-PAGE under reducing condition (kDa): 60-70 |
AA Sequence : | NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISIS NVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQEL HGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPRE GQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPS PVPSSSSTYHASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | CADM3 cell adhesion molecule 3 [ Homo sapiens ] |
Official Symbol | CADM3 |
Synonyms | CADM3; cell adhesion molecule 3; IGSF4B, immunoglobulin superfamily, member 4B; BIgR; FLJ10698; Necl 1; NECL1; nectin like 1; SynCAM3; TSLL1; TSLC1-like 1; nectin-like 1; TSLC1-like protein 1; nectin-like protein 1; brain immunoglobulin receptor; synaptic cell adhesion molecule 3; immunoglobulin superfamily member 4B; immunoglobulin superfamily, member 4B; dendritic cell nectin-like protein 1 short isoform; IGSF4B; Necl-1; synCAM3; |
Gene ID | 57863 |
mRNA Refseq | NM_001127173 |
Protein Refseq | NP_001120645 |
MIM | 609743 |
UniProt ID | Q8N126 |
Chromosome Location | 1q21.2-q22 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; Nectin/Necltrans heterodimerization, organism-specific biosystem; |
Function | protein homodimerization activity; |
◆ Recombinant Proteins | ||
Cadm3-3301M | Recombinant Mouse Cadm3 protein(Met1-His328), His-tagged | +Inquiry |
CADM3-745R | Recombinant Rat CADM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cadm3-543R | Recombinant Rat Cadm3, Fc-tagged | +Inquiry |
CADM3-1662C | Recombinant Cynomolgus CADM3 protein, His-tagged | +Inquiry |
CADM3-185H | Recombinant Human CADM3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CADM3-2556HCL | Recombinant Human CADM3 cell lysate | +Inquiry |
CADM3-2275MCL | Recombinant Mouse CADM3 cell lysate | +Inquiry |
CADM3-738RCL | Recombinant Rat CADM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CADM3 Products
Required fields are marked with *
My Review for All CADM3 Products
Required fields are marked with *
0
Inquiry Basket