Active Recombinant Human CD34, His-tagged, Biotinylated

Cat.No. : CD34-572H
Product Overview : The recombinant human CD34 ECD protein is expressed as a 280-amino acid protein consisting of Ser32 - Thr290 region of (UniProt accession #P28906) and a C-terminal His-tag. It contains 9 potential N-linked glycosylation sites.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : 32-290 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Interacts with L-selectin and supports the adhesion of the human umbilical vein endothelial cell line (HUVEC). Binds anti-CD34 monoclonal antibodies, human IgG1 and rabbit IgG by ELISA with this immobilized protein.
Molecular Mass : Calculated molecular mass (kDa): 30; Estimated by SDS-PAGE under reducing condition (kDa): 75-90 suggesting that the protein may be heavily glycosylated.
AA Sequence : SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNT NSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGI REVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEIS SKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTSTTENLYFQGSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >92% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Conjugation : Biotin
Gene Name CD34 CD34 molecule [ Homo sapiens ]
Official Symbol CD34
Synonyms CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34;
Gene ID 947
mRNA Refseq NM_001025109
Protein Refseq NP_001020280
MIM 142230
UniProt ID P28906
Chromosome Location 1q32
Pathway Adaptive Immune System, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Immune System, organism-specific biosystem;
Function carbohydrate binding; sulfate binding; transcription factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD34 Products

Required fields are marked with *

My Review for All CD34 Products

Required fields are marked with *

0
cart-icon