Active Recombinant Human CDNF, His-tagged, Biotinylated
Cat.No. : | CDNF-591H |
Product Overview : | The recombinant human CDNF is expressed as a 174 amino acid protein consisting of Gln25 - Leu187 region of CDNF (UniProt entry Q49AH0) and a C-terminal poly-Histidine tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Protein Length : | 25-187 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | CDNF is reported to enhance neurite outgrowth of E18 rat embryonic cortical neurons and increases neurite outgrowth when immobilized at 6 - 24 μg/mL on a nitrocellulose- coated microplate. |
Molecular Mass : | Calculated molecular mass 19.9 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with a higher molecular mass band (~25 kDa) resembling a glycosylated state. |
AA Sequence : | QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEV TRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQE LAPKYAATHPKTELSTGHHHHHHHH |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | CDNF cerebral dopamine neurotrophic factor [ Homo sapiens ] |
Official Symbol | CDNF |
Synonyms | CDNF; cerebral dopamine neurotrophic factor; arginine rich, mutated in early stage tumors like 1 , ARMETL1; conserved dopamine neurotrophic factor; ARMET-like protein 1; arginine-rich, mutated in early stage tumors-like 1; ARMETL1; |
Gene ID | 441549 |
mRNA Refseq | NM_001029954 |
Protein Refseq | NP_001025125 |
MIM | 611233 |
UniProt ID | Q49AH0 |
Chromosome Location | 10p13 |
Function | growth factor activity; |
◆ Recombinant Proteins | ||
CDNF-592H | Active Recombinant Human CDNF, His-tagged | +Inquiry |
CDNF-537H | Active Recombinant Human CDNF | +Inquiry |
Cdnf-485M | Recombinant Mouse Cdnf Protein, His/GST-tagged | +Inquiry |
CDNF-716H | Recombinant Human CDNF Protein, His-tagged | +Inquiry |
CDNF-069H | Recombinant Human cerebral dopamine neurotrophic factor Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDNF-2028MCL | Recombinant Mouse CDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDNF Products
Required fields are marked with *
My Review for All CDNF Products
Required fields are marked with *