Active Recombinant Human CLDN6 Full Length Transmembrane protein, His-tagged(VLPs)
| Cat.No. : | CLDN6-1446H |
| Product Overview : | Recombinant Human CLDN6 Protein(P56747)(1-220aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 1-220aa |
| Form : | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/mL can bind Anti-CLDN6/9 recombinant antibody, the EC50 is 1.501-2.035 ng/Ml |
| Molecular Mass : | 25.1 kDa |
| AA Sequence : | MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
| Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CLDN6 claudin 6 [ Homo sapiens ] |
| Official Symbol | CLDN6 |
| Synonyms | CLDN6; claudin 6; claudin-6; skullin; |
| Gene ID | 9074 |
| mRNA Refseq | NM_021195 |
| Protein Refseq | NP_067018 |
| UniProt ID | P56747 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN6 Products
Required fields are marked with *
My Review for All CLDN6 Products
Required fields are marked with *



