Active Recombinant Human CLDN6 Full Length Transmembrane protein, His-tagged(VLPs)
Cat.No. : | CLDN6-1446H |
Product Overview : | Recombinant Human CLDN6 Protein(P56747)(1-220aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-220aa |
Form : | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/mL can bind Anti-CLDN6/9 recombinant antibody, the EC50 is 1.501-2.035 ng/Ml |
Molecular Mass : | 25.1 kDa |
AA Sequence : | MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CLDN6 claudin 6 [ Homo sapiens ] |
Official Symbol | CLDN6 |
Synonyms | CLDN6; claudin 6; claudin-6; skullin; |
Gene ID | 9074 |
mRNA Refseq | NM_021195 |
Protein Refseq | NP_067018 |
UniProt ID | P56747 |
◆ Recombinant Proteins | ||
CLDN6-137H | Recombinant Human CLDN6 protein | +Inquiry |
CLDN6-4765M | Recombinant Mouse CLDN6 Full Length Transmembrane protein(VLPs) | +Inquiry |
CLDN6-8654H | Active Recombinant Human CLDN6 Full Length Transmembrane protein(VLPs) | +Inquiry |
CLDN6-392H | Active Recombinant Human CLDN6 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CLDN6-393H | Active Recombinant Human CLDN6 Full Length Transmembrane protein(MNP) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN6-7460HCL | Recombinant Human CLDN6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN6 Products
Required fields are marked with *
My Review for All CLDN6 Products
Required fields are marked with *
0
Inquiry Basket