Active Recombinant Human CTF1 protein
| Cat.No. : | CTF1-122H |
| Product Overview : | Recombinant human CTF1 was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Form : | 1.0 mg/ml, sterile-filtered, in PBS Buffer, no any carrier protein. |
| Bio-activity : | Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 0.25 – 0.85 ng/ml. |
| AA Sequence : | SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAP SHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPR AEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
| Endotoxin : | < 1EU per 1 ug of protein by the LAL method |
| Purity : | >95% by SDS-PAGE and visualized by silver stain. |
| Applications : | 1. Active recombinant protein, may be used for its functional assay.2. As immunogen for specific antibody production. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | CTF1 cardiotrophin 1 [ Homo sapiens ] |
| Official Symbol | CTF1 |
| Synonyms | CTF1; cardiotrophin 1; cardiotrophin-1; CT 1; CT1; cardiophin 1; CT-1; |
| Gene ID | 1489 |
| mRNA Refseq | NM_001142544 |
| Protein Refseq | NP_001136016 |
| MIM | 600435 |
| UniProt ID | Q16619 |
| Chromosome Location | 16p11.2 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem; |
| Function | cytokine activity; leukemia inhibitory factor receptor binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTF1 Products
Required fields are marked with *
My Review for All CTF1 Products
Required fields are marked with *
