Active Recombinant Human CTF1 protein
Cat.No. : | CTF1-122H |
Product Overview : | Recombinant human CTF1 was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Form : | 1.0 mg/ml, sterile-filtered, in PBS Buffer, no any carrier protein. |
Bio-activity : | Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 0.25 – 0.85 ng/ml. |
AA Sequence : | SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAP SHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPR AEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
Endotoxin : | < 1EU per 1 ug of protein by the LAL method |
Purity : | >95% by SDS-PAGE and visualized by silver stain. |
Applications : | 1. Active recombinant protein, may be used for its functional assay.2. As immunogen for specific antibody production. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | CTF1 cardiotrophin 1 [ Homo sapiens ] |
Official Symbol | CTF1 |
Synonyms | CTF1; cardiotrophin 1; cardiotrophin-1; CT 1; CT1; cardiophin 1; CT-1; |
Gene ID | 1489 |
mRNA Refseq | NM_001142544 |
Protein Refseq | NP_001136016 |
MIM | 600435 |
UniProt ID | Q16619 |
Chromosome Location | 16p11.2 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem; |
Function | cytokine activity; leukemia inhibitory factor receptor binding; |
◆ Recombinant Proteins | ||
Ctf1-183M | Recombinant Murine Cardiotrophin 1 | +Inquiry |
Ctf1-1174R | Recombinant Rat Ctf1 protein | +Inquiry |
CTF1-239H | Recombinant Human CTF1 protein(Ser2-Ala201), hFc-tagged | +Inquiry |
CTF1-1653R | Recombinant Rat CTF1 Protein | +Inquiry |
CTF1-8450H | Active Recombinant Human CTF1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTF1-001HCL | Recombinant Human CTF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTF1 Products
Required fields are marked with *
My Review for All CTF1 Products
Required fields are marked with *