Active Recombinant Human CXCL8 Protein
Cat.No. : | CXCL8-231C |
Product Overview : | Recombinant Human CXCL8 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | Interleukin-8 (IL-8), also known as CXCL8, GCP-1 and NAP-1, is a proinflammatory chemokine belonging to the intercrine alpha (chemokine CXC) family. It is secreted by monocytes, macrophages and endothelial cells. IL-8 signals through CXCR1 and CXCR2 to chemoattract neutrophils, basophils, and T cells. IL-8 is also a potent promoter of angiogenesis. Other functions of this protein, such as involvement in bronchiolitis pathogenesis, have also been reported. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 6 ng/mL, measured in a calcium flux assay using CHO/Gα15 cells transiently expressing CXCR1. |
Molecular Mass : | ~9 kDa, observed by reducing SDS-PAGE |
AA Sequence : | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Human Interleukin-8 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-8 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | CXCL8 C-X-C motif chemokine ligand 8 [ Homo sapiens (human) ] |
Official Symbol | CXCL8 |
Synonyms | CXCL8; C-X-C motif chemokine ligand 8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8; interleukin-8; T-cell chemotactic factor; alveolar macrophage chemotactic factor I; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; chemokine (C-X-C motif) ligand 8; emoctakin; granulocyte chemotactic protein 1; interleukin 8; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; neutrophil-activating peptide 1; small inducible cytokine subfamily B, member 8; tumor necrosis factor-induced gene 1 |
Gene ID | 3576 |
mRNA Refseq | NM_000584 |
Protein Refseq | NP_000575 |
MIM | 146930 |
UniProt ID | P10145 |
◆ Recombinant Proteins | ||
CXCL8-107C | Active Recombinant Human CXCL8 Protein (77 aa) | +Inquiry |
CXCL8-5677D | Recombinant Dog CXCL8 protein, rFc-tagged | +Inquiry |
CXCL8-693H | Recombinant Human CXCL8 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL8-231H | Recombinant Human CXCL8 Protein, His-tagged | +Inquiry |
CXCL8-5455H | Recombinant Human CXCL8 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CXCL8-052H | Active Recombinant Human CXCL8 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL8 Products
Required fields are marked with *
My Review for All CXCL8 Products
Required fields are marked with *