Active Recombinant Human DKK1 protein
| Cat.No. : | DKK1-276H |
| Product Overview : | Recombinant Human DKK1 was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Non |
| Description : | This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. |
| Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
| Bio-activity : | Determined by its ability to inhibit the proliferation of HCT116 colorectal carcinoma cells. Approximately 40% growth inhibition was achieved at a DKK-1 concentration of 200ng/ml. |
| Molecular Mass : | 28.67 kDa |
| AA Sequence : | TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Resuspend the protein in the desired concentration in proper buffer |
| Gene Name | DKK1 dickkopf 1 homolog (Xenopus laevis) [ Homo sapiens ] |
| Official Symbol | DKK1 |
| Synonyms | DKK1; dickkopf 1 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 1; dickkopf-related protein 1; DKK 1; SK; hDkk-1; dickkopf-1 like; dickkopf related protein-1; DKK-1; |
| Gene ID | 22943 |
| mRNA Refseq | NM_012242 |
| Protein Refseq | NP_036374 |
| MIM | 605189 |
| UniProt ID | O94907 |
| ◆ Recombinant Proteins | ||
| DKK1-229H | Recombinant Human DKK1, C13&N15-labeled | +Inquiry |
| DKK1-068H | Recombinant Human DKK1 Protein, THR32-HIS266, Tag Free, Biotinylated | +Inquiry |
| DKK1-2340R | Recombinant Rhesus DKK1, Fc tagged | +Inquiry |
| DKK1-275H | Recombinant Human DKK1 protein, DDK-tagged | +Inquiry |
| DKK1-276H | Active Recombinant Human DKK1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DKK1-2622RCL | Recombinant Rhesus DKK1 cell lysate | +Inquiry |
| DKK1-2983HCL | Recombinant Human DKK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DKK1 Products
Required fields are marked with *
My Review for All DKK1 Products
Required fields are marked with *
