Active Recombinant Human EPO Protein (166 aa)
Cat.No. : | EPO-289E |
Product Overview : | Recombinant Human EPO Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Protein Length : | 166 |
Description : | Erythropoietin (EPO), a glycoprotein produced primarily by the kidney, is the principal factor that regulates erythropoiesis by stimulating the proliferation and differentiation of erythroid progenitor cells. The production of EPO by kidney cells is increased in response to hypoxia or anemia. Recombinant EPO has been approved for the treatment of anemia associated with chronic renal failure as well as for anemia of AZT treated AIDS patients. The cDNAs for EPO have been cloned from human, mouse, canine, etc. The mature proteins from the various species are highly conserved, exhibiting greater than 80% sequence identity at the amino acid level. Human EPO cDNA encodes a 193 amino acid residue precursor protein that is processed to yield a 165 amino acid residue mature protein. EPO contains one O-linked and three N-linked glycosylation sites. Glycosylation of EPO is required for EPO biological activities in vivo. EPO exhibits structural as well as amino sequence identity to the amino terminal 153 amino acid region of thrombopoietin. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50< 1 ng/mL, measured in a cell proliferation assay using TF-1 human erythroleukemic cells, corresponding to a specific activity of >1 × 10^6units/mg |
Molecular Mass : | Mature human EPO, containing 166 amino acid residues, has a predicted molecular mass of approximately 21 kDa. As a result of glycosylation, the recombinant protein migrates with an apparent molecular mass of 26-36 kDa in SDS-PAGE. |
AA Sequence : | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant human EPO remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhEPO should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | EPO erythropoietin [ Homo sapiens ] |
Official Symbol | EPO |
Synonyms | EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142; |
Gene ID | 2056 |
mRNA Refseq | NM_000799 |
Protein Refseq | NP_000790 |
MIM | 133170 |
UniProt ID | P01588 |
◆ Recombinant Proteins | ||
EPO-269H | Active Recombinant Human Erythropoietin | +Inquiry |
EPO-163H | Active Recombinant Human Erythropoietin | +Inquiry |
EPO-517H | Recombinant Human EPO protein | +Inquiry |
EPO-234H | Active Recombinant Human EPO, Fc-tagged | +Inquiry |
EPO-100E | Recombinant Equine EPO | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
EPO-1450MCL | Recombinant Mouse EPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPO Products
Required fields are marked with *
My Review for All EPO Products
Required fields are marked with *
0
Inquiry Basket