Active Recombinant Human EPO Protein

Cat.No. : EPO-589H
Product Overview : Recombinant Human EPO Protein was expressed without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Description : Erythropoietin (EPO), a glycoprotein produced primarily by the kidney, is the principal factor that regulates erythropoiesis by stimulating the proliferation and differentiation of erythroid progenitor cells. The production of EPO by kidney cells is increased in response to hypoxia or anemia. Recombinant EPO has been approved for the treatment of anemia associated with chronic renal failure as well as for anemia of AZT treated AIDS patients.
Form : Sterile Filtered White lyophil
Bio-activity : Fully biologically active when compared to standard. The Specific Activity was measured by the stimulation of reticulocyte production in normocyth-aemic mice and is no less than 1.5×10^5 IU/mg.
AA Sequence : APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Endotoxin : Less than 0.01 EU/μg of rHuEPO-a as determined by LAL method.
Purity : > 98% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in sodium citrate buffer.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL.
Gene Name EPO erythropoietin [ Homo sapiens (human) ]
Official Symbol EPO
Synonyms EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142;
Gene ID 2056
mRNA Refseq NM_00799
Protein Refseq NP_00790
MIM 133170
UniProt ID P01588

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPO Products

Required fields are marked with *

My Review for All EPO Products

Required fields are marked with *

0
cart-icon