Active Recombinant Human FCGR2B Protein, His-tagged
| Cat.No. : | FCGR2B-650H |
| Product Overview : | Recombinant Human FCGR2B protein(Ala46-Pro217), fused with C-terminal His tag, was expressed in HEK293. |
| Availability | July 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Ala46-Pro217 |
| Tag : | C-His |
| Form : | Liquid in sterile PBS, pH7.4. |
| Molecular Mass : | The protein has a calculated MW of 21 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPAHHHHHHHHHH |
| Gene Name | FCGR2B Fc fragment of IgG, low affinity IIb, receptor (CD32) [ Homo sapiens ] |
| Official Symbol | FCGR2B |
| Synonyms | FCGR2B; Fc fragment of IgG, low affinity IIb, receptor (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32) , FCG2, FCGR2; low affinity immunoglobulin gamma Fc region receptor II-b; CD32; CD32B; CDw32; fcRII-b; Fc gamma RIIb; fc-gamma-RIIb; fc-gamma RII-b; igG Fc receptor II-b; Fc fragment of IgG, low affinity II, receptor for (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32); FCG2; FCGR2; IGFR2; |
| Gene ID | 2213 |
| mRNA Refseq | NM_001002273 |
| Protein Refseq | NP_001002273 |
| MIM | 604590 |
| UniProt ID | P31994 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR2B Products
Required fields are marked with *
My Review for All FCGR2B Products
Required fields are marked with *
