Active Recombinant Human FCGR2B Protein, His-tagged

• Cat.No.: FCGR2B-650H
• Product Overview: Recombinant Human FCGR2B protein(Ala46-Pro217), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Ala46-Pro217
• Tag: C-His
• Form: Liquid in sterile PBS, pH7.4.
• Molecular Mass: The protein has a calculated MW of 21 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPAHHHHHHHHHH

Gene Information

• Gene Name: FCGR2B Fc fragment of IgG, low affinity IIb, receptor (CD32) [ Homo sapiens ]
• Official Symbol: FCGR2B
• Synonyms: FCGR2B; Fc fragment of IgG, low affinity IIb, receptor (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32) , FCG2, FCGR2; low affinity immunoglobulin gamma Fc region receptor II-b; CD32; CD32B; CDw32; fcRII-b; Fc gamma RIIb; fc-gamma-RIIb; fc-gamma RII-b; igG Fc receptor II-b; Fc fragment of IgG, low affinity II, receptor for (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32); FCG2; FCGR2; IGFR2
• Gene ID: 2213
• mRNA Refseq: NM_001002273
• Protein Refseq: NP_001002273
• MIM: 604590
• UniProt ID: P31994