Active Recombinant Human FCGR2B Protein, His-tagged
Cat.No. : | FCGR2B-650H |
Product Overview : | Recombinant Human FCGR2B protein(Ala46-Pro217), fused with C-terminal His tag, was expressed in HEK293. |
Availability | October 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Ala46-Pro217 |
Tag : | C-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The protein has a calculated MW of 21 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPAHHHHHHHHHH |
Gene Name | FCGR2B Fc fragment of IgG, low affinity IIb, receptor (CD32) [ Homo sapiens ] |
Official Symbol | FCGR2B |
Synonyms | FCGR2B; Fc fragment of IgG, low affinity IIb, receptor (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32) , FCG2, FCGR2; low affinity immunoglobulin gamma Fc region receptor II-b; CD32; CD32B; CDw32; fcRII-b; Fc gamma RIIb; fc-gamma-RIIb; fc-gamma RII-b; igG Fc receptor II-b; Fc fragment of IgG, low affinity II, receptor for (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32); FCG2; FCGR2; IGFR2; |
Gene ID | 2213 |
mRNA Refseq | NM_001002273 |
Protein Refseq | NP_001002273 |
MIM | 604590 |
UniProt ID | P31994 |
◆ Recombinant Proteins | ||
FCGR2B-032H | Recombinant Human FCGR2B Protein, C-His-tagged | +Inquiry |
Fcgr2b-3185M | Recombinant Mouse Fcgr2b Protein, His (Fc)-Avi-tagged | +Inquiry |
FCGR2B-2595H | Recombinant Human FCGR2B Protein (Thr43-Pro217), C-His tagged | +Inquiry |
FCGR2B-323H | Recombinant Human FCGR2B protein, His-Avi-tagged | +Inquiry |
FCGR2B-278C | Active Recombinant Cynomolgus Monkey FCGR2B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR2B-1988HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
FCGR2B-1942RCL | Recombinant Rat FCGR2B cell lysate | +Inquiry |
FCGR2B-001HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
FCGR2B-1994CCL | Recombinant Cynomolgus FCGR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR2B Products
Required fields are marked with *
My Review for All FCGR2B Products
Required fields are marked with *