Active Recombinant Human FCGR3A Protein (18-208aa), C-His-tagged

Cat.No. : FCGR3A-02H
Product Overview : Recombinant human FCGR3A (18-208aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability August 25, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 18-208aa
Description : This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other responses, including antibody dependent cellular mediated cytotoxicity and antibody dependent enhancement of virus infections. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene are associated with immunodeficiency 20, and have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Human IgG1 Fc.
Molecular Mass : 22.8 kDa (200aa)
AA Sequence : MRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name FCGR3A Fc gamma receptor IIIa [ Homo sapiens (human) ]
Official Symbol FCGR3A
Synonyms FCGR3A; Fc gamma receptor IIIa; CD16; FCG3; CD16A; FCGR3; IGFR3; IMD20; FCR-10; FCRIII; CD16-II; FCGRIII; FCRIIIA; FcGRIIIA; low affinity immunoglobulin gamma Fc region receptor III-A; CD16a antigen; Fc fragment of IgG receptor IIIa; Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc gamma receptor III-A; Fc-gamma RIII-alpha; Fc-gamma receptor III-2 (CD 16); Fc-gamma receptor IIIb (CD16); FcgammaRIIIA; IgG Fc receptor III-A; igG Fc receptor III-2; immunoglobulin G Fc receptor III; low affinity immunoglobulin gamma Fc region receptor III-A/III-B recombinant; low affinity immunoglobulin gamma Fc region receptor III-B; low affinity immunoglobulin gamma receptor III-a Fc fragment; neutrophil-specific antigen NA
Gene ID 2214
mRNA Refseq NM_001127593
Protein Refseq NP_001121065
MIM 146740
UniProt ID P08637

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCGR3A Products

Required fields are marked with *

My Review for All FCGR3A Products

Required fields are marked with *

0
cart-icon