Active Recombinant Human FGFR4, Fc-tagged, Biotinylated
Cat.No. : | FGFR4-614H |
Product Overview : | The recombinant human FGFR4 ECD is expressed as a 577 amino acid protein consisting of Leu22 - Asp369 region of FGFR4 (Uniprot accession #P22455 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 22-369 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) |
Bio-activity : | Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells with an ED50 of 0.01 - 0.05 μg/ml |
Molecular Mass : | Calculated molecular mass (kDa): 64.1; Estimated by SDS-PAGE under reducing condition (kDa): 75-85 |
AA Sequence : | LEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPED AGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVK FRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLDVLE RSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEV LYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTAAAPEARYTDGSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | FGFR4 fibroblast growth factor receptor 4 [ Homo sapiens ] |
Official Symbol | FGFR4 |
Synonyms | FGFR4; fibroblast growth factor receptor 4; CD334; JTK2; FGFR-4; tyrosylprotein kinase; protein-tyrosine kinase; hydroxyaryl-protein kinase; tyrosine kinase related to fibroblast growth factor receptor; TKF; MGC20292; |
Gene ID | 2264 |
mRNA Refseq | NM_002011 |
Protein Refseq | NP_002002 |
MIM | 134935 |
UniProt ID | P22455 |
Chromosome Location | 5q33-qter |
Pathway | Downstream signaling of activated FGFR, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR4 ligand binding and activation, organism-specific biosystem; FRS2-mediated cascade, organism-specific biosystem; |
Function | ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor 2 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein tyrosine kinase activity; receptor activity; |
◆ Recombinant Proteins | ||
FGFR4-6C | Recombinant Cynomolgus Monkey FGFR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGFR4-4062HFL | Recombinant Full Length Human FGFR4, Flag-tagged | +Inquiry |
FGFR4-8839RAF647 | Recombinant Monkey FGFR4 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
FGFR4-151H | Recombinant Human FGFR4 Protein, DYKDDDDK-tagged | +Inquiry |
FGFR4-5420H | Recombinant Human FGFR4 Protein (22-369aa), C-His tagged | +Inquiry |
◆ Native Proteins | ||
FGFR4-41H | Active Recombinant Human FGFR4 Homodimer Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFR4-2757MCL | Recombinant Mouse FGFR4 cell lysate | +Inquiry |
FGFR4-1907HCL | Recombinant Human FGFR4 cell lysate | +Inquiry |
FGFR4-1516RCL | Recombinant Rat FGFR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFR4 Products
Required fields are marked with *
My Review for All FGFR4 Products
Required fields are marked with *