Active Recombinant Human FGFR4, Fc-tagged, Biotinylated

Cat.No. : FGFR4-614H
Product Overview : The recombinant human FGFR4 ECD is expressed as a 577 amino acid protein consisting of Leu22 - Asp369 region of FGFR4 (Uniprot accession #P22455 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 22-369 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule)
Bio-activity : Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells with an ED50 of 0.01 - 0.05 μg/ml
Molecular Mass : Calculated molecular mass (kDa): 64.1; Estimated by SDS-PAGE under reducing condition (kDa): 75-85
AA Sequence : LEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPED AGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVK FRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLDVLE RSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEV LYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTAAAPEARYTDGSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Conjugation : Biotin
Gene Name FGFR4 fibroblast growth factor receptor 4 [ Homo sapiens ]
Official Symbol FGFR4
Synonyms FGFR4; fibroblast growth factor receptor 4; CD334; JTK2; FGFR-4; tyrosylprotein kinase; protein-tyrosine kinase; hydroxyaryl-protein kinase; tyrosine kinase related to fibroblast growth factor receptor; TKF; MGC20292;
Gene ID 2264
mRNA Refseq NM_002011
Protein Refseq NP_002002
MIM 134935
UniProt ID P22455
Chromosome Location 5q33-qter
Pathway Downstream signaling of activated FGFR, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR4 ligand binding and activation, organism-specific biosystem; FRS2-mediated cascade, organism-specific biosystem;
Function ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor 2 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein tyrosine kinase activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGFR4 Products

Required fields are marked with *

My Review for All FGFR4 Products

Required fields are marked with *

0
cart-icon