Active Recombinant Human FUT1 Protein (AA 26-365), N-6×His/GFP tagged

• Cat.No.: FUT1-24H
• Product Overview: Recombinant Human FUT1 Protein (AA 26-365) with N-6×His/GFP tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: GFP&His
• Protein Length: AA 26-365
• Description: This gene encodes a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the synthesis of soluble A and B antigens. This is one of two genes encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
• Bio-activity: ≥ 0.02 μmol/min/mg
• Molecular Mass: ~70 kDa
• AA Sequence: HIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP
• Purity: >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
• Stability: 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
• Concentration: 1 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
• Preservative: 0.05 % NaN3
• Shipping: This product is shipped as 0.2μm filtered product on dry ice.

Gene Information

• Gene Name: FUT1 fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group) [ Homo sapiens (human) ]
• Official Symbol: FUT1
• Synonyms: FUT1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group); fucosyltransferase 1 (galactoside 2 alpha L fucosyltransferase) , fucosyltransferase 1 (galactoside 2 alpha L fucosyltransferase, Bombay phenotype included) , H, HSC; galactoside 2-alpha-L-fucosyltransferase 1; alpha(1,2)FT 1; 2-alpha-L-fucosyltransferase; alpha (1,2) fucosyltransferase; blood group H alpha 2-fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); H; HH; HSC
• Gene ID: 2523
• mRNA Refseq: NM_000148
• Protein Refseq: NP_000139
• MIM: 211100
• UniProt ID: P19526