Active Recombinant Human FUT1 Protein (AA 26-365), N-6×His/GFP tagged
Cat.No. : | FUT1-24H |
Product Overview : | Recombinant Human FUT1 Protein (AA 26-365) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | GFP&His |
Protein Length : | AA 26-365 |
Description : | This gene encodes a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the synthesis of soluble A and B antigens. This is one of two genes encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. |
Bio-activity : | ≥ 0.02 μmol/min/mg |
Molecular Mass : | ~70 kDa |
AA Sequence : | HIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP |
Purity : | >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain. |
Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
Concentration : | 1 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
Preservative : | 0.05 % NaN3 |
Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
Gene Name | FUT1 fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group) [ Homo sapiens (human) ] |
Official Symbol | FUT1 |
Synonyms | FUT1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group); fucosyltransferase 1 (galactoside 2 alpha L fucosyltransferase) , fucosyltransferase 1 (galactoside 2 alpha L fucosyltransferase, Bombay phenotype included) , H, HSC; galactoside 2-alpha-L-fucosyltransferase 1; alpha(1,2)FT 1; 2-alpha-L-fucosyltransferase; alpha (1,2) fucosyltransferase; blood group H alpha 2-fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); H; HH; HSC; |
Gene ID | 2523 |
mRNA Refseq | NM_000148 |
Protein Refseq | NP_000139 |
MIM | 211100 |
UniProt ID | P19526 |
◆ Recombinant Proteins | ||
FUT1-1589R | Recombinant Rhesus Macaque FUT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Fut1-3108M | Recombinant Mouse Fut1 Protein, Myc/DDK-tagged | +Inquiry |
FUT1-2411R | Recombinant Rat FUT1 Protein | +Inquiry |
RFL8881MF | Recombinant Full Length Mouse Galactoside 2-Alpha-L-Fucosyltransferase 1(Fut1) Protein, His-Tagged | +Inquiry |
FUT1-6744H | Recombinant Human FUT1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUT1-6117HCL | Recombinant Human FUT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT1 Products
Required fields are marked with *
My Review for All FUT1 Products
Required fields are marked with *