Active Recombinant Human HHLA2, Fc-tagged, Biotinylated

• Cat.No.: HHLA2-550H
• Product Overview: The recombinant human B7-H7-Fc fusion protein is expressed as a 574 amino acid protein consisting of Ile23 - Lys345 region of HHLA2/B7-H7 (UniProt accession #Q9UM44) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 23-345 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Inhibits anti-CD3 antibody induced cytokine (e.g., IFN- and IL-2) secretion in human T lymphocytes.
• Molecular Mass: Calculated molecular mass 65.0 kDa; estimated by SDS-PAGE under reducing condition ~75 kDa probably due to glycosylation
• AA Sequence: MKAQTALSFFLILITSLSGSQGIFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSY YKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFLTPVMKY EKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYECTIENSLLKQTWT GRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQNTIINESRFSWNKELIN QSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHNKGSTGTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Conjugation: Biotin

Gene Information

• Gene Name: HHLA2 HERV-H LTR-associating 2 [ Homo sapiens ]
• Official Symbol: HHLA2
• Synonyms: HHLA2; HERV-H LTR-associating 2; HERV-H LTR-associating protein 2; human endogenous retrovirus-H long terminal repeat-associating protein 2
• Gene ID: 11148
• mRNA Refseq: NM_007072
• Protein Refseq: NP_009003
• MIM: 604371
• UniProt ID: Q9UM44
• Chromosome Location: 3q13.13
• Function: molecular_function