Active Recombinant Human HHLA2, Fc-tagged, Biotinylated

Cat.No. : HHLA2-550H
Product Overview : The recombinant human B7-H7-Fc fusion protein is expressed as a 574 amino acid protein consisting of Ile23 - Lys345 region of HHLA2/B7-H7 (UniProt accession #Q9UM44) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 23-345 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Inhibits anti-CD3 antibody induced cytokine (e.g., IFN- and IL-2) secretion in human T lymphocytes.
Molecular Mass : Calculated molecular mass 65.0 kDa; estimated by SDS-PAGE under reducing condition ~75 kDa probably due to glycosylation
AA Sequence : MKAQTALSFFLILITSLSGSQGIFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSY YKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFLTPVMKY EKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYECTIENSLLKQTWT GRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQNTIINESRFSWNKELIN QSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHNKGSTGTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Conjugation : Biotin
Gene Name HHLA2 HERV-H LTR-associating 2 [ Homo sapiens ]
Official Symbol HHLA2
Synonyms HHLA2; HERV-H LTR-associating 2; HERV-H LTR-associating protein 2; human endogenous retrovirus-H long terminal repeat-associating protein 2;
Gene ID 11148
mRNA Refseq NM_007072
Protein Refseq NP_009003
MIM 604371
UniProt ID Q9UM44
Chromosome Location 3q13.13
Function molecular_function;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HHLA2 Products

Required fields are marked with *

My Review for All HHLA2 Products

Required fields are marked with *

0
cart-icon