Active Recombinant Human HHLA2, Fc-tagged, Biotinylated
Cat.No. : | HHLA2-550H |
Product Overview : | The recombinant human B7-H7-Fc fusion protein is expressed as a 574 amino acid protein consisting of Ile23 - Lys345 region of HHLA2/B7-H7 (UniProt accession #Q9UM44) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 23-345 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Inhibits anti-CD3 antibody induced cytokine (e.g., IFN- and IL-2) secretion in human T lymphocytes. |
Molecular Mass : | Calculated molecular mass 65.0 kDa; estimated by SDS-PAGE under reducing condition ~75 kDa probably due to glycosylation |
AA Sequence : | MKAQTALSFFLILITSLSGSQGIFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSY YKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFLTPVMKY EKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYECTIENSLLKQTWT GRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQNTIINESRFSWNKELIN QSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHNKGSTGTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | HHLA2 HERV-H LTR-associating 2 [ Homo sapiens ] |
Official Symbol | HHLA2 |
Synonyms | HHLA2; HERV-H LTR-associating 2; HERV-H LTR-associating protein 2; human endogenous retrovirus-H long terminal repeat-associating protein 2; |
Gene ID | 11148 |
mRNA Refseq | NM_007072 |
Protein Refseq | NP_009003 |
MIM | 604371 |
UniProt ID | Q9UM44 |
Chromosome Location | 3q13.13 |
Function | molecular_function; |
◆ Recombinant Proteins | ||
HHLA2-549H | Recombinant Human HHLA2 protein, His-tagged | +Inquiry |
HHLA2-421H | Active Recombinant Human HHLA2 protein, Fc-tagged | +Inquiry |
HHLA2-2898C | Active Recombinant Cynomolgus HHLA2 protein, His-tagged | +Inquiry |
HHLA2-550H | Active Recombinant Human HHLA2, Fc-tagged, Biotinylated | +Inquiry |
HHLA2-1103H | Recombinant Human HHLA2 protein(Met1-Asn344), His-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
HHLA2-5569HCL | Recombinant Human HHLA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HHLA2 Products
Required fields are marked with *
My Review for All HHLA2 Products
Required fields are marked with *
0
Inquiry Basket