Active Recombinant Human IFNL1 Protein
Cat.No. : | IFNL1-17H |
Product Overview : | Recombinant Human IFNL1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 178 amino acids |
Description : | This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 is determined in an anti-viral assay using human HepG2 cells infected with encephalomyocarditis is typically 1-5 ng/mL, corresponding to a Specific Activity of >2 × 10^5 IU/mg. |
Molecular Mass : | 19.8 kDa, a single non-glycosylated polypeptide chain containing 178 amino acids. |
AA Sequence : | PTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST |
Endotoxin : | Less than 1 EU/μg of rHuIFN-λ1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 or -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IFNL1 interferon lambda 1 [ Homo sapiens (human) ] |
Official Symbol | IFNL1 |
Synonyms | IFNL1; interferon lambda 1; IL29; IL-29; interferon lambda-1 IFN-lambda-1 cytokine Zcyto21 interleukin 29 (interferon, lambda 1) interleukin-29 |
Gene ID | 282618 |
mRNA Refseq | NM_172140 |
Protein Refseq | NP_742152 |
MIM | 607403 |
UniProt ID | Q8IU54 |
◆ Recombinant Proteins | ||
IFNL1-118H | Recombinant Human IFNL1 Protein | +Inquiry |
IFNL1-299H | Recombinant Human IFNL1, StrepII-tagged | +Inquiry |
IFNL1-3689H | Recombinant Human IFNL1 Protein (Gly20-Thr200), His tagged | +Inquiry |
Ifnl1-1653R | Recombinant Rat Ifnl1 Protein, His&GST-tagged | +Inquiry |
IFNL1-02H | Active Recombinant Human IFNL1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IFNL1-047H | Active Recombinant Human IFNL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNL1-2007HCL | Recombinant Human IFNL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNL1 Products
Required fields are marked with *
My Review for All IFNL1 Products
Required fields are marked with *