| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Description : |
This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28B (IL28B), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). |
| Form : |
Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
| Bio-activity : |
Determined by its ability to activate STAT phosphorylation in an ISRE Luciferase Reporter Assay using human colon carcinoma COLO205 cells. The expected ED50 is 0.3-0.5 ng/ml. |
| Molecular Mass : |
19.6 kDa |
| AA Sequence : |
PVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV |
| Endotoxin : |
Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : |
>95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : |
Resuspend the protein in the desired concentration in proper buffer |